Project name: 62109a22362b079

Status: done

Started: 2026-07-01 15:23:25
Settings
Chain sequence(s) B: ESKLIQTHTLQVSAGGPLSSVTFVFNGDHTLTVPLTLPAGATVRLQARTA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:22)
Show buried residues

Minimal score value
-2.5221
Maximal score value
2.3433
Average score
-0.6156
Total score value
-30.7823

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E B -2.4618
2 S B -2.0801
3 K B -2.4099
4 L B -1.2052
5 I B -0.7294
6 Q B -1.6819
7 T B -1.7998
8 H B -2.0849
9 T B -1.4861
10 L B -1.0633
11 Q B -1.4704
12 V B -0.6557
13 S B -0.7011
14 A B -0.5954
15 G B -0.6366
16 G B -0.5381
17 P B -0.3662
18 L B -0.0115
19 S B -0.0103
20 S B 0.2595
21 V B 1.0082
22 T B 1.4294
23 F B 2.3433
24 V B 2.0008
25 F B 0.9393
26 N B -1.2162
27 G B -1.2400
28 D B -2.2161
29 H B -0.8346
30 T B 0.8249
31 L B 2.2676
32 T B 1.3493
33 V B 1.1100
34 P B 0.3725
35 L B 0.3694
36 T B 0.0548
37 L B 0.0000
38 P B -0.5225
39 A B -0.6662
40 G B -0.8182
41 A B -0.6717
42 T B -0.8611
43 V B -1.0791
44 R B -2.2528
45 L B -1.7434
46 Q B -2.0969
47 A B -1.4600
48 R B -2.5221
49 T B -1.7494
50 A B -1.1733
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018