Project name: 62ebd82038ac395

Chain sequence(s)	A: SFMLTQPPSVSGSPGRTVAISCTRTSGSIASGFVHWYQQRPGSPPTLLIFENDQRSAGVSERFSGSLDSSSNTATLSISGLKTEDEAHYHCQSFERMTWVFGGGTKLTVL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:14)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:15)

• Minimal score value: -2.8048
• Maximal score value: 1.8151
• Average score: -0.5473
• Total score value: -60.2078

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	A	-0.3313
2	F	A	0.0000
3	M	A	1.0290
4	L	A	0.0000
5	T	A	0.0263
6	Q	A	-0.3875
7	P	A	-0.5347
8	P	A	-0.8113
9	S	A	-0.7612
10	V	A	-0.3007
11	S	A	-0.0731
12	G	A	-0.2800
13	S	A	-0.4456
14	P	A	-1.1757
15	G	A	-1.9066
16	R	A	-2.4525
17	T	A	-1.4002
18	V	A	0.0000
19	A	A	-0.0540
20	I	A	0.0000
21	S	A	-0.1566
22	C	A	0.0000
23	T	A	-0.2977
24	R	A	-0.2463
25	T	A	-0.0942
26	S	A	-0.4143
27	G	A	-0.7630
28	S	A	-0.7937
29	I	A	0.0000
30	A	A	-0.1236
31	S	A	-0.0254
32	G	A	0.2054
33	F	A	0.8517
34	V	A	0.0000
35	H	A	-0.0173
36	W	A	0.0000
37	Y	A	0.1127
38	Q	A	0.0000
39	Q	A	-1.6791
40	R	A	-2.4679
41	P	A	-1.4709
42	G	A	-1.0526
43	S	A	-1.0181
44	P	A	-0.7772
45	P	A	-0.7510
46	T	A	-0.2128
47	L	A	0.3237
48	L	A	0.0000
49	I	A	0.0000
50	F	A	-0.7561
51	E	A	-1.3869
52	N	A	-1.3633
53	D	A	-2.6006
54	Q	A	-2.4206
55	R	A	-2.0110
56	S	A	-0.6807
57	A	A	-0.6013
58	G	A	-0.6998
59	V	A	-0.6303
60	S	A	-1.1915
61	E	A	-2.1953
62	R	A	-1.3330
63	F	A	0.0000
64	S	A	-1.4350
65	G	A	-1.3660
66	S	A	-1.1935
67	L	A	-0.6904
68	D	A	-1.4587
69	S	A	-1.0582
70	S	A	-0.8599
71	S	A	-0.8738
72	N	A	-0.9898
73	T	A	-0.7619
74	A	A	0.0000
75	T	A	-0.5513
76	L	A	0.0000
77	S	A	-0.2790
78	I	A	0.0000
79	S	A	-1.4255
80	G	A	-1.7315
81	L	A	0.0000
82	K	A	-2.4721
83	T	A	-1.7870
84	E	A	-2.8048
85	D	A	0.0000
86	E	A	-2.5657
87	A	A	0.0000
88	H	A	-1.9711
89	Y	A	0.0000
90	H	A	-0.2999
91	C	A	0.0000
92	Q	A	0.0000
93	S	A	0.0000
94	F	A	1.4217
95	E	A	0.2363
96	R	A	-1.0592
97	M	A	0.5916
98	T	A	0.8271
99	W	A	1.8151
100	V	A	1.6395
101	F	A	1.7788
102	G	A	0.4572
103	G	A	-0.3853
104	G	A	-0.7355
105	T	A	0.0000
106	K	A	-1.9772
107	L	A	0.0000
108	T	A	-0.5176
109	V	A	-0.3312
110	L	A	1.2037