Project name: query_structure

Status: done

Started: 2026-03-16 23:46:10
Settings
Chain sequence(s) A: GTPSADQVRYNYTELPNGEYCYTPRRRCTSADQCCRPYDTTAAFHGCGRIWPKDKREKVDRCYICNNEKTLCTSVM
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:24)
Show buried residues

Minimal score value
-4.6155
Maximal score value
1.1312
Average score
-1.2287
Total score value
-93.3822

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.5524
2 T A -0.3828
3 P A -1.0687
4 S A -0.9066
5 A A -1.0413
6 D A -2.0987
7 Q A -1.8025
8 V A -1.0721
9 R A -1.3026
10 Y A -0.0922
11 N A 0.0848
12 Y A 1.1312
13 T A -0.2370
14 E A -2.0324
15 L A 0.0000
16 P A -1.8890
17 N A -2.3183
18 G A -2.2300
19 E A -2.4719
20 Y A -0.7584
21 C A -0.4692
22 Y A -0.5340
23 T A -0.4328
24 P A -0.8873
25 R A -1.4829
26 R A -2.9371
27 R A -3.1971
28 C A -1.8494
29 T A -1.1301
30 S A -1.0671
31 A A -1.1245
32 D A -1.9676
33 Q A -1.5091
34 C A 0.0000
35 C A 0.0000
36 R A -0.5334
37 P A 0.0000
38 Y A -0.2689
39 D A -1.7475
40 T A -0.8338
41 T A -0.6787
42 A A -1.3159
43 A A 0.0000
44 F A -0.2238
45 H A -0.2606
46 G A 0.0000
47 C A -1.3279
48 G A -1.7889
49 R A -2.6720
50 I A -0.4053
51 W A -0.7335
52 P A -2.2367
53 K A -2.8786
54 D A 0.0000
55 K A -4.5884
56 R A -4.6155
57 E A -4.5444
58 K A -4.4384
59 V A -3.3864
60 D A -3.0085
61 R A -2.6483
62 C A 0.0000
63 Y A -0.5933
64 I A 0.0000
65 C A 0.0000
66 N A 0.0000
67 N A -2.5629
68 E A -2.7665
69 K A -2.5744
70 T A -1.3536
71 L A -0.6571
72 C A -0.1871
73 T A 0.1836
74 S A 0.5010
75 V A 0.4479
76 M A 0.9447
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018