Project name: CO_SC

Status: done

Started: 2026-06-18 19:20:41
Settings
Chain sequence(s) A: ESVGLHLPTLSVQEGDNSIINCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAESRESYIPTFGRGTSLIVHGGGGSGGGGSGGGGSGVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLCASSQRGQGRRAKNIQYFGAGTRLSVL
input PDB
Selected Chain(s) A
Distance of aggregation 5 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:51)
Show buried residues

Minimal score value
-2.2551
Maximal score value
1.6585
Average score
-0.3022
Total score value
-72.5256

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.8585
2 S A -0.2211
3 V A 1.6487
4 G A 0.1362
5 L A 1.2859
6 H A -0.6766
7 L A -0.0260
8 P A -0.1618
9 T A -0.0092
10 L A 0.3215
11 S A 0.0274
12 V A -0.0555
13 Q A -1.5443
14 E A -1.8459
15 G A -0.8337
16 D A -1.0407
17 N A -1.4043
18 S A 0.0000
19 I A 0.8965
20 I A 0.0000
21 N A -1.2760
22 C A 0.0000
23 A A 0.0419
24 Y A 0.0981
25 S A -0.3542
26 N A -0.9796
27 S A -0.3710
28 A A -0.0144
29 S A 0.0000
30 D A -0.2430
31 Y A 0.0000
32 F A 0.0000
33 I A 0.0000
34 W A 0.0000
35 Y A 0.0000
36 K A -0.2545
37 Q A -0.2230
38 E A -0.3159
39 S A -0.3434
40 G A -0.7024
41 K A -1.1898
42 G A 0.0000
43 P A 0.0000
44 Q A -0.4990
45 F A 0.5726
46 I A 0.4664
47 I A 0.0000
48 D A 0.0000
49 I A 0.0000
50 R A 0.0000
51 S A -0.2860
52 N A -1.2202
53 M A -0.2292
54 D A -2.0080
55 K A -1.9162
56 R A -1.0950
57 Q A -1.3748
58 G A -0.8026
59 Q A -1.3498
60 R A -0.6457
61 V A 0.1655
62 T A -0.1266
63 V A 0.0000
64 L A 0.2435
65 L A 0.0000
66 N A -1.2227
67 K A -1.9473
68 T A -0.0561
69 V A 1.6585
70 K A -0.5241
71 H A -0.4207
72 L A 0.0000
73 S A -0.1851
74 L A 0.0000
75 Q A -0.4203
76 I A 0.0000
77 A A -0.1089
78 A A -0.0872
79 T A 0.0000
80 Q A -0.8191
81 P A -0.3644
82 G A -0.3619
83 D A 0.0000
84 S A 0.0196
85 A A 0.0000
86 V A 0.2954
87 Y A 0.0000
88 F A 0.0000
89 C A 0.0000
90 A A 0.0000
91 E A -0.2009
92 S A 0.0000
93 R A -2.0100
94 E A -1.5055
95 S A 0.0000
96 Y A 1.2025
97 I A 0.5067
98 P A 0.0000
99 T A -0.0347
100 F A 0.1587
101 G A -0.2247
102 R A -0.7954
103 G A -0.1707
104 T A -0.0235
105 S A 0.0030
106 L A 0.0000
107 I A 1.0219
108 V A 0.0000
109 H A -1.0627
110 G A -0.7021
111 G A -0.6357
112 G A -0.6358
113 G A -0.5900
114 S A -0.3828
115 G A -0.5930
116 G A -0.6414
117 G A -0.6399
118 G A -0.5924
119 S A -0.3860
120 G A -0.5929
121 G A -0.6390
122 G A -0.6379
123 G A -0.5905
124 S A -0.3728
125 G A -0.4318
126 V A 0.0978
127 A A 0.0324
128 Q A -0.1692
129 S A -0.1830
130 P A -0.4395
131 R A -1.6167
132 Y A 0.6005
133 K A -0.2972
134 I A 1.4137
135 I A 0.0000
136 E A -1.8173
137 K A -1.6556
138 R A -2.1709
139 Q A -1.1541
140 S A -0.5043
141 V A 0.0000
142 A A -0.0628
143 F A 0.0000
144 W A 0.5417
145 C A 0.0000
146 N A -0.4187
147 P A 0.0000
148 I A 0.2780
149 S A -0.2396
150 G A -0.5220
151 H A -0.3266
152 A A -0.0022
153 T A 0.0000
154 L A 0.0000
155 Y A 0.0000
156 W A 0.0000
157 Y A 0.0000
158 Q A 0.0000
159 Q A 0.0299
160 I A 0.8453
161 L A 1.6394
162 G A 0.0380
163 Q A -1.0044
164 G A -0.3034
165 P A 0.0000
166 K A -1.1952
167 L A -0.0614
168 L A 0.0000
169 I A 0.0000
170 Q A 0.0000
171 F A 0.0000
172 Q A -0.7035
173 N A -1.5971
174 N A -1.5485
175 G A -0.1831
176 V A 1.6209
177 V A 1.2571
178 D A -0.3289
179 D A -0.6798
180 S A -0.5302
181 Q A -1.2367
182 L A 0.0000
183 P A -0.4097
184 K A -2.0408
185 D A -2.1439
186 R A -0.7161
187 F A 0.0000
188 S A -0.2004
189 A A -0.3639
190 E A -1.8182
191 R A 0.0000
192 L A 1.2420
193 K A -1.4374
194 G A -0.5767
195 V A 0.6160
196 D A -0.4930
197 S A 0.0000
198 T A 0.0522
199 L A 0.0000
200 K A -0.7519
201 I A 0.0000
202 Q A -1.2679
203 P A -0.6490
204 A A 0.0000
205 K A -0.3534
206 L A 1.1371
207 E A -1.3796
208 D A 0.0000
209 S A -0.0576
210 A A 0.0000
211 V A 0.1810
212 Y A 0.0000
213 L A 0.0000
214 C A 0.0000
215 A A 0.0000
216 S A 0.0000
217 S A 0.0000
218 Q A -1.4142
219 R A -1.3811
220 G A -0.6881
221 Q A -1.3302
222 G A -1.0080
223 R A -2.2551
224 R A -2.1713
225 A A -0.5190
226 K A -0.8669
227 N A 0.0000
228 I A 0.2722
229 Q A 0.0000
230 Y A 0.9568
231 F A 0.3795
232 G A 0.0000
233 A A -0.0839
234 G A 0.0000
235 T A 0.0000
236 R A -1.5610
237 L A 0.0000
238 S A 0.1388
239 V A 0.0000
240 L A 1.3316
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018