Project name: query_structure

Status: done

Started: 2026-03-17 01:25:59
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVIFYVITYGETGGNSPVQAFKVPGSKSTATISGLSPGVDYTITVYAQGYQSRWYRNSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:30)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:30)
Show buried residues

Minimal score value
-2.6736
Maximal score value
2.0668
Average score
-0.4138
Total score value
-38.4811

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.8253
2 S A 0.7901
3 S A 0.4432
4 V A 0.0026
5 P A 0.0000
6 T A -1.6753
7 K A -2.6424
8 L A 0.0000
9 E A -1.8770
10 V A 0.0986
11 V A 1.5363
12 A A 0.8964
13 A A 0.2961
14 T A -0.2019
15 P A -0.8056
16 T A -0.5318
17 S A -0.3168
18 L A 0.0000
19 L A 0.7539
20 I A 0.0000
21 S A -0.9731
22 W A 0.0000
23 D A -2.6736
24 A A -1.2189
25 P A 0.0625
26 A A 0.5630
27 V A 1.1048
28 T A 0.9130
29 V A 1.2292
30 I A 2.0668
31 F A 0.6817
32 Y A 0.0000
33 V A -0.2019
34 I A 0.0000
35 T A 0.2476
36 Y A 0.1606
37 G A -0.3799
38 E A -1.3676
39 T A -1.2680
40 G A -1.2460
41 G A -1.4155
42 N A -1.5485
43 S A -0.8683
44 P A -0.1115
45 V A 0.9035
46 Q A 0.1087
47 A A 0.0456
48 F A -0.3474
49 K A -1.3123
50 V A 0.0000
51 P A -0.5235
52 G A -0.0701
53 S A -0.6337
54 K A -1.7383
55 S A -1.3800
56 T A -0.7558
57 A A 0.0000
58 T A 0.2434
59 I A 0.0000
60 S A -0.4718
61 G A -0.6849
62 L A 0.0000
63 S A -0.8426
64 P A -0.9945
65 G A -1.0941
66 V A -0.9371
67 D A -1.9329
68 Y A 0.0000
69 T A -0.8105
70 I A 0.0000
71 T A 0.2144
72 V A 0.0000
73 Y A -0.2228
74 A A -0.0026
75 Q A -0.0331
76 G A 0.8130
77 Y A 0.9603
78 Q A -0.6059
79 S A -1.2004
80 R A -1.7174
81 W A -0.6673
82 Y A -0.9189
83 R A -2.3588
84 N A -2.0282
85 S A -1.0397
86 P A -0.4107
87 I A -0.2050
88 S A -0.4747
89 I A -0.7161
90 N A -1.7601
91 Y A -1.5090
92 R A -2.3793
93 T A -1.3386
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018