Project name: obj1 [mutate: GH10C, FK27C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	GH10C,FK27C
Energy difference between WT (input) and mutated protein (by FoldX)	3.19498 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:22)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:31)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:54)

• Minimal score value: -3.3336
• Maximal score value: 1.5827
• Average score: -0.7477
• Total score value: -89.722

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-1.9876
2	V	C	-1.4004
3	Q	C	-1.2093
4	L	C	0.0000
5	V	C	0.5766
6	E	C	0.2393
7	S	C	-0.4643
8	G	C	-0.9265
9	G	C	-0.2528
10	H	C	0.1791	mutated: GH10C
11	L	C	1.0612
12	V	C	-0.2342
13	Q	C	-1.3543
14	P	C	-1.5022
15	G	C	-1.3907
16	G	C	-0.9190
17	S	C	-1.2055
18	L	C	-1.0429
19	R	C	-2.1231
20	L	C	0.0000
21	S	C	-0.5244
22	C	C	0.0000
23	A	C	-0.1817
24	A	C	0.0000
25	S	C	-1.0039
26	D	C	0.0000
27	K	C	-2.0827	mutated: FK27C
28	T	C	-1.5253
29	F	C	0.0000
30	R	C	-2.6556
31	S	C	-1.3557
32	Y	C	-1.2182
33	E	C	-1.1461
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.2977
40	A	C	-0.9850
41	P	C	-1.2942
42	G	C	-1.4348
43	K	C	-2.1350
44	G	C	-1.0592
45	L	C	0.3944
46	E	C	-0.3909
47	W	C	0.3405
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5835
53	G	C	-1.2692
54	S	C	-1.2559
55	G	C	-1.1007
56	G	C	-0.7345
57	S	C	-0.3027
58	T	C	0.1987
59	Y	C	0.6074
60	Y	C	-0.3559
61	A	C	-1.1386
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6175
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6722
70	I	C	0.0000
71	S	C	-0.5774
72	R	C	-1.4015
73	D	C	-2.0522
74	N	C	-2.3419
75	S	C	-1.8621
76	K	C	-2.3643
77	N	C	-2.2262
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6696
81	L	C	0.0000
82	Q	C	-1.2353
83	M	C	0.0000
84	N	C	-1.3170
85	S	C	-1.2147
86	L	C	0.0000
87	R	C	-2.4788
88	A	C	-1.9121
89	E	C	-2.3504
90	D	C	0.0000
91	T	C	-0.5179
92	A	C	0.0000
93	I	C	1.0104
94	Y	C	0.0000
95	Y	C	0.6440
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1908
101	D	C	-3.3336
102	G	C	-2.0878
103	F	C	-1.2339
104	N	C	-2.4298
105	K	C	-3.1855
106	G	C	-1.9081
107	F	C	-0.9864
108	D	C	-1.0977
109	Y	C	-0.2071
110	W	C	0.5581
111	G	C	-0.0686
112	Q	C	-0.8796
113	G	C	0.1199
114	T	C	0.4857
115	L	C	1.5827
116	V	C	0.0000
117	T	C	0.1169
118	V	C	0.0000
119	S	C	-0.8366
120	S	C	-1.0921