Project name: query_structure

Status: done

Started: 2026-03-17 01:23:38
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYHITYGETGGGSSGQEFTVPGSKSTATISGLSPGVDYTITVYAWMYDGYEYTYQGTSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:33)
Show buried residues

Minimal score value
-2.3785
Maximal score value
1.8345
Average score
-0.406
Total score value
-38.9803

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.8345
2 S A 0.7410
3 S A 0.6364
4 V A 0.5554
5 P A 0.0000
6 T A -1.2833
7 K A -2.3785
8 L A 0.0000
9 E A -1.7878
10 V A 0.0747
11 V A 1.5186
12 A A 0.8777
13 A A 0.2957
14 T A -0.3887
15 P A -0.8101
16 T A -0.5337
17 S A -0.3265
18 L A 0.0000
19 L A 0.7112
20 I A 0.0000
21 S A -0.7837
22 W A 0.0000
23 D A -1.7181
24 A A -0.7785
25 P A 0.3151
26 A A 0.6571
27 V A 0.8645
28 T A 0.3173
29 V A 0.0000
30 D A -0.1363
31 Y A 0.5409
32 Y A 0.0000
33 H A 0.1394
34 I A 0.0000
35 T A -1.1699
36 Y A 0.0000
37 G A -1.5748
38 E A -1.6919
39 T A -1.4014
40 G A -1.1003
41 G A -1.2706
42 G A -1.0687
43 S A -1.1419
44 S A -1.2471
45 G A -1.7583
46 Q A -2.3385
47 E A -2.2951
48 F A -0.6948
49 T A 0.0337
50 V A 0.0000
51 P A -0.6234
52 G A -0.7524
53 S A -1.1500
54 K A -1.9601
55 S A -1.1216
56 T A -0.6450
57 A A 0.0000
58 T A 0.2815
59 I A 0.0000
60 S A -0.4788
61 G A -0.8139
62 L A 0.0000
63 S A -0.8529
64 P A -1.0013
65 G A -1.0917
66 V A -0.9199
67 D A -1.9130
68 Y A 0.0000
69 T A -1.0448
70 I A 0.0000
71 T A -0.3673
72 V A 0.0000
73 Y A 0.6280
74 A A 0.0000
75 W A 0.8834
76 M A 0.0000
77 Y A 0.7677
78 D A -0.4563
79 G A -0.2573
80 Y A 0.3638
81 E A -0.6769
82 Y A 0.5877
83 T A 0.5181
84 Y A 0.9845
85 Q A 0.1935
86 G A -0.0380
87 T A -0.1130
88 S A -0.1251
89 P A 0.1093
90 I A -0.1057
91 S A -0.5405
92 I A -0.7636
93 N A -1.7803
94 Y A -1.4632
95 R A -2.3554
96 T A -1.3211
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018