Project name: query_structure

Status: done

Started: 2026-03-17 01:11:14
Settings
Chain sequence(s) A: VSDVPRDLEVVAATPTSLLISWDAPAVTVDYYVITYGETGVGWVPGQTFEVPGSKSTATISGLKPGVDYTITVYAYHEYYFISPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:30)
Show buried residues

Minimal score value
-3.7516
Maximal score value
2.7037
Average score
-0.4189
Total score value
-38.1202

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.4620
2 S A -0.1504
3 D A -1.0978
4 V A -0.8010
5 P A 0.0000
6 R A -3.7516
7 D A -3.6149
8 L A 0.0000
9 E A -2.2076
10 V A 0.0835
11 V A 1.5429
12 A A 0.8984
13 A A 0.3046
14 T A -0.3484
15 P A -1.1251
16 T A -1.0020
17 S A -0.5366
18 L A 0.0000
19 L A 0.7454
20 I A 0.0000
21 S A -1.2027
22 W A 0.0000
23 D A -3.3975
24 A A -1.8839
25 P A -0.8294
26 A A 0.1577
27 V A 0.3511
28 T A -0.4497
29 V A 0.0000
30 D A -1.0527
31 Y A -0.8938
32 Y A 0.0000
33 V A 0.1137
34 I A 0.0000
35 T A -0.4603
36 Y A 0.0000
37 G A -0.3818
38 E A -0.8388
39 T A -0.6251
40 G A 0.2072
41 V A 1.4816
42 G A 0.8826
43 W A 1.5205
44 V A 1.1845
45 P A 0.0820
46 G A -0.1566
47 Q A -1.1355
48 T A -0.7743
49 F A -0.6017
50 E A -1.3757
51 V A 0.0000
52 P A -1.2362
53 G A -1.2135
54 S A -1.2558
55 K A -2.0048
56 S A -1.3990
57 T A -0.7736
58 A A 0.0000
59 T A 0.2913
60 I A 0.0000
61 S A -0.7826
62 G A -1.1596
63 L A 0.0000
64 K A -2.3893
65 P A -1.6602
66 G A -1.4381
67 V A -1.4409
68 D A -1.8959
69 Y A 0.0000
70 T A -0.8977
71 I A 0.0000
72 T A -0.0214
73 V A 0.0000
74 Y A 0.8442
75 A A 0.0000
76 Y A 1.3047
77 H A 0.1034
78 E A -0.8062
79 Y A 1.4692
80 Y A 2.3422
81 F A 2.7037
82 I A 1.4258
83 S A 0.3801
84 P A 0.1257
85 I A -0.2453
86 S A -0.6912
87 I A -0.7538
88 N A -1.7800
89 Y A -1.5159
90 R A -2.5518
91 T A -1.5205
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018