Project name: 666

Status: done

Started: 2026-04-14 06:28:10
Settings
Chain sequence(s) A: MHHHHHHENLYFQGAAGERGAPGFRGPAGPNGIPGEKGPAGERGAAGERGAPGFRGPAGPNGIPGEKGPAGERGAAGERGAPGFRGPAGPNGIPGEKGPAGERGGGGSGGGGSGGGGSSGPSEGGSSSTMYVSGPPGPPGPPGPPGSISSSGQEIQQYISEYMQSDSIRSYLSGVQGPPGPPGPPGPVTTITGETFDYSELASHVVSYLRTSGYGVSLFSSSISSEDILAVLQRDDVRQYLRQYLM
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:30)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:33)
Show buried residues

Minimal score value
-3.7011
Maximal score value
2.6106
Average score
-0.9136
Total score value
-224.7471

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.2157
2 H A -1.3413
3 H A -2.0793
4 H A -2.4903
5 H A -2.8330
6 H A -3.0056
7 H A -2.8953
8 E A -2.7011
9 N A -1.1911
10 L A 1.3015
11 Y A 2.0118
12 F A 2.1457
13 Q A 0.1160
14 G A -0.3701
15 A A -0.5447
16 A A -1.1378
17 G A -1.8868
18 E A -3.0283
19 R A -3.0802
20 G A -1.9741
21 A A -0.8504
22 P A -0.6205
23 G A -0.1927
24 F A 0.6458
25 R A -1.2972
26 G A -1.0309
27 P A -0.7709
28 A A -0.9036
29 G A -1.0468
30 P A -1.0143
31 N A -1.3501
32 G A -0.3625
33 I A 1.2356
34 P A -0.4679
35 G A -1.4816
36 E A -3.0192
37 K A -3.0213
38 G A -1.9152
39 P A -0.9227
40 A A -1.1875
41 G A -1.8903
42 E A -3.0207
43 R A -3.0181
44 G A -1.8437
45 A A -0.6650
46 A A -1.2259
47 G A -1.8727
48 E A -3.2940
49 R A -3.7011
50 G A -2.2332
51 A A -1.3394
52 P A -0.7660
53 G A -0.2935
54 F A 0.4300
55 R A -1.3369
56 G A -1.1027
57 P A -0.8171
58 A A -0.9745
59 G A -1.2072
60 P A -1.0081
61 N A -1.2692
62 G A -0.3878
63 I A 1.2163
64 P A -0.4912
65 G A -1.6819
66 E A -3.0257
67 K A -2.9903
68 G A -1.9046
69 P A -0.9448
70 A A -1.2556
71 G A -1.8795
72 E A -3.0197
73 R A -3.0195
74 G A -1.8115
75 A A -0.6641
76 A A -1.1393
77 G A -2.3927
78 E A -3.4409
79 R A -3.3751
80 G A -2.2686
81 A A -0.7924
82 P A -0.6508
83 G A -0.2620
84 F A 0.6348
85 R A -1.1220
86 G A -1.1073
87 P A -0.8107
88 A A -0.8847
89 G A -1.0576
90 P A -0.9733
91 N A -1.2771
92 G A -0.3629
93 I A 0.9818
94 P A -0.5039
95 G A -1.5092
96 E A -2.8243
97 K A -3.0058
98 G A -1.9782
99 P A -1.4267
100 A A -1.3272
101 G A -1.9477
102 E A -3.1315
103 R A -3.2339
104 G A -2.2798
105 G A -1.7585
106 G A -1.3888
107 G A -1.1229
108 S A -0.9417
109 G A -1.0638
110 G A -1.1240
111 G A -1.0715
112 G A -1.0120
113 S A -0.8616
114 G A -1.0035
115 G A -1.0711
116 G A -1.0613
117 G A -0.9949
118 S A -0.7350
119 S A -0.7198
120 G A -1.0508
121 P A -1.1561
122 S A -1.5822
123 E A -2.4113
124 G A -1.7550
125 G A -1.3666
126 S A -0.9739
127 S A -0.4952
128 S A 0.0410
129 T A 0.8883
130 M A 2.0741
131 Y A 2.5108
132 V A 2.4633
133 S A 0.8698
134 G A -0.1893
135 P A -0.5686
136 P A -0.9390
137 G A -1.1288
138 P A -0.9944
139 P A -0.9623
140 G A -1.0704
141 P A -0.6795
142 P A -0.8840
143 G A -1.1633
144 P A -0.7045
145 P A -0.6012
146 G A -0.4223
147 S A 0.3215
148 I A 1.1862
149 S A 0.4533
150 S A -0.3707
151 S A -1.1588
152 G A -1.8559
153 Q A -2.6832
154 E A -2.4460
155 I A -0.8907
156 Q A -2.0973
157 Q A -2.2874
158 Y A -0.5644
159 I A 0.0740
160 S A -1.0289
161 E A -1.7607
162 Y A -0.6759
163 M A -0.6350
164 Q A -2.0856
165 S A -2.1797
166 D A -2.5104
167 S A -1.4201
168 I A 0.0000
169 R A -2.1640
170 S A -1.0503
171 Y A 0.0958
172 L A 0.2653
173 S A 0.0122
174 G A 0.2389
175 V A 1.1076
176 Q A -0.5856
177 G A -1.0339
178 P A -0.9753
179 P A -1.2228
180 G A -1.2497
181 P A -0.9364
182 P A -0.9167
183 G A -1.1822
184 P A -0.9026
185 P A -0.4724
186 G A -0.6025
187 P A 0.1628
188 V A 1.5317
189 T A 0.7484
190 T A 0.3955
191 I A 1.4614
192 T A 0.1236
193 G A -0.7573
194 E A -1.5848
195 T A -0.2603
196 F A 0.2326
197 D A -0.8083
198 Y A 0.4205
199 S A -0.5394
200 E A -1.3515
201 L A -0.0519
202 A A -0.0974
203 S A -0.3106
204 H A -0.3562
205 V A 0.0937
206 V A 0.3310
207 S A -0.4317
208 Y A -0.2439
209 L A 0.0000
210 R A -1.8055
211 T A -0.9928
212 S A -0.8317
213 G A -0.9975
214 Y A -0.5493
215 G A -0.6171
216 V A 0.5866
217 S A 1.1105
218 L A 2.5217
219 F A 2.6106
220 S A 1.2754
221 S A 0.4213
222 S A 0.3743
223 I A 1.1050
224 S A -0.0155
225 S A -0.2271
226 E A -1.2769
227 D A -0.7249
228 I A 0.8626
229 L A 0.7502
230 A A -0.2512
231 V A 0.0000
232 L A -0.5839
233 Q A -1.7115
234 R A -2.5605
235 D A -3.4249
236 D A -2.7473
237 V A 0.0000
238 R A -3.4065
239 Q A -3.0880
240 Y A -1.6078
241 L A -1.1049
242 R A -1.8323
243 Q A -1.2407
244 Y A 0.3712
245 L A 1.4395
246 M A 1.2064
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018