Project name: 65b74bc0d49dcac

Chain sequence(s)	A: QVQLQESGGGLVQAGGSLRLSCEASGDIESIRAMGWFRQAPGKQREFVGFISIDPRTGETTLNYGDFVKGRFTISRDNAKNTVYLQMSNLKSEDTGVYFCAASHWGTLLLKGIEYWGKGTQVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:02)

• Minimal score value: -3.1407
• Maximal score value: 1.4412
• Average score: -0.7657
• Total score value: -96.4828

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
2	Q	A	-1.3341
3	V	A	-0.5150
4	Q	A	-1.5497
5	L	A	0.0000
6	Q	A	-2.3142
7	E	A	0.0000
8	S	A	-1.3079
9	G	A	-1.1533
10	G	A	-0.6695
11	G	A	0.0520
12	L	A	1.1580
13	V	A	0.0757
14	Q	A	-1.3336
15	A	A	-1.5829
16	G	A	-1.7100
17	G	A	-1.1231
18	S	A	-1.3392
19	L	A	-0.9210
20	R	A	-2.0607
21	L	A	0.0000
22	S	A	-1.3028
23	C	A	0.0000
24	E	A	-2.8351
25	A	A	0.0000
26	S	A	-1.3288
27	G	A	-0.7844
28	D	A	-0.3525
29	I	A	1.4412
30	E	A	0.0000
31	S	A	0.5924
32	I	A	1.3603
33	R	A	0.4881
34	A	A	0.0000
35	M	A	0.0000
36	G	A	0.0000
37	W	A	0.0000
38	F	A	0.0000
39	R	A	-1.3271
40	Q	A	-2.0308
41	A	A	-1.8850
42	P	A	-1.2856
43	G	A	-1.8218
44	K	A	-3.1407
45	Q	A	-3.0616
46	R	A	-2.6611
47	E	A	-2.5235
48	F	A	-0.8079
49	V	A	0.0000
50	G	A	0.0000
51	F	A	0.0000
52	I	A	0.0000
53	S	A	0.0000
54	I	A	0.0000
55	D	A	-1.2955
56	P	A	-1.4721
57	R	A	-2.6009
58	T	A	-1.7850
59	G	A	-1.7603
60	E	A	-2.4128
61	T	A	-1.4627
62	T	A	-0.5572
63	L	A	-0.0283
64	N	A	-0.4807
65	Y	A	-0.4313
66	G	A	-0.7339
67	D	A	-1.4784
68	F	A	0.4101
69	V	A	0.0000
70	K	A	-1.7896
71	G	A	-1.3687
72	R	A	-1.2474
73	F	A	0.0000
74	T	A	-0.7391
75	I	A	0.0000
76	S	A	-0.4914
77	R	A	-1.1587
78	D	A	-1.7167
79	N	A	-1.2762
80	A	A	-1.1554
81	K	A	-2.3327
82	N	A	-1.6792
83	T	A	0.0000
84	V	A	0.0000
85	Y	A	-0.8599
86	L	A	0.0000
87	Q	A	-1.2536
88	M	A	0.0000
89	S	A	-1.4914
90	N	A	-2.0687
91	L	A	0.0000
92	K	A	-2.4444
93	S	A	-1.8575
94	E	A	-2.0584
95	D	A	0.0000
96	T	A	-0.8338
97	G	A	0.0000
98	V	A	-0.4009
99	Y	A	0.0000
100	F	A	-0.7180
101	C	A	0.0000
102	A	A	0.0000
103	A	A	0.0000
104	S	A	-0.1786
105	H	A	-0.4967
106	W	A	0.6666
107	G	A	0.0000
108	T	A	0.5252
109	L	A	0.6827
110	L	A	0.0000
111	L	A	0.4678
112	K	A	-1.2085
113	G	A	-0.8683
114	I	A	0.0000
115	E	A	-1.6767
116	Y	A	-0.2817
117	W	A	-0.4661
118	G	A	-1.2450
119	K	A	-1.9276
120	G	A	-1.2157
121	T	A	-1.0089
122	Q	A	-0.6706
123	V	A	0.0000
124	T	A	-0.1576
125	V	A	0.0000
126	S	A	-0.7066
127	S	A	-0.7906