Project name: obj1 [mutate: FL27C, LT45C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	LT45C,FL27C
Energy difference between WT (input) and mutated protein (by FoldX)	1.81859 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:22)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:26)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:47)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:47)

• Minimal score value: -3.3314
• Maximal score value: 1.7631
• Average score: -0.7096
• Total score value: -85.1491

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-1.9994
2	V	C	-0.9602
3	Q	C	-1.2392
4	L	C	0.0000
5	V	C	0.5643
6	E	C	0.2216
7	S	C	-0.4097
8	G	C	-0.8149
9	G	C	0.0130
10	G	C	0.9254
11	L	C	1.4406
12	V	C	-0.0385
13	Q	C	-1.3371
14	P	C	-1.4887
15	G	C	-1.4134
16	G	C	-0.9785
17	S	C	-1.2309
18	L	C	-0.9630
19	R	C	-2.1462
20	L	C	0.0000
21	S	C	-0.5418
22	C	C	0.0000
23	A	C	-0.2017
24	A	C	0.0000
25	S	C	-0.2940
26	D	C	0.0000
27	L	C	1.1531	mutated: FL27C
28	T	C	0.0455
29	F	C	0.0000
30	R	C	-2.1406
31	S	C	-0.9515
32	Y	C	-1.2141
33	E	C	-1.1444
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.9365
40	A	C	-1.2998
41	P	C	-1.3104
42	G	C	-1.5955
43	K	C	-2.4828
44	G	C	-1.7929
45	T	C	-1.1056	mutated: LT45C
46	E	C	-1.1220
47	W	C	-0.0038
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5835
53	G	C	-1.2671
54	S	C	-1.2559
55	G	C	-1.1007
56	G	C	-0.7345
57	S	C	-0.3027
58	T	C	0.1987
59	Y	C	0.6074
60	Y	C	-0.3559
61	A	C	-1.1386
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6175
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6722
70	I	C	0.0000
71	S	C	-0.5774
72	R	C	-1.4015
73	D	C	-2.0522
74	N	C	-2.3398
75	S	C	-1.8621
76	K	C	-2.3643
77	N	C	-1.7643
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6696
81	L	C	0.0000
82	Q	C	-1.2337
83	M	C	0.0000
84	N	C	-1.3327
85	S	C	-1.2322
86	L	C	0.0000
87	R	C	-2.4721
88	A	C	-1.8894
89	E	C	-2.3444
90	D	C	0.0000
91	T	C	-0.4305
92	A	C	0.0000
93	I	C	0.8870
94	Y	C	0.0000
95	Y	C	0.4583
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1862
101	D	C	-3.3314
102	G	C	-2.0860
103	F	C	-1.2320
104	N	C	-2.4279
105	K	C	-3.1825
106	G	C	-1.9013
107	F	C	-0.9745
108	D	C	-1.0952
109	Y	C	-0.2094
110	W	C	0.5508
111	G	C	-0.0719
112	Q	C	-0.8785
113	G	C	0.1027
114	T	C	0.5880
115	L	C	1.7631
116	V	C	0.0000
117	T	C	0.3392
118	V	C	0.0000
119	S	C	-0.7749
120	S	C	-1.0602