Project name: 65e5547bd8e3354

Status: done

Started: 2026-06-27 15:53:02
Settings
Chain sequence(s) A: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
C: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
B: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
D: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
input PDB
Selected Chain(s) A,C,B,D
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:49)
Show buried residues

Minimal score value
-3.3107
Maximal score value
2.289
Average score
-0.3264
Total score value
-48.3118

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 K A -2.7618
2 C A -1.7462
3 N A -1.9534
4 T A -0.8362
5 A A -0.1275
6 T A 0.0000
7 C A 0.6997
8 A A 0.0000
9 T A -0.5336
10 Q A 0.0000
11 R A -2.4929
12 L A -0.8748
13 A A -0.0897
14 N A 1.0079
15 F A 2.2890
16 L A 0.0000
17 V A -0.2861
18 R A -2.6227
19 S A -1.8865
20 S A -1.3162
21 N A -1.3740
22 N A 0.0792
23 L A 1.5825
24 G A 1.2992
25 P A 1.3637
26 V A 2.2142
27 L A 0.9338
28 P A 0.1782
29 P A -0.5101
30 T A -0.8134
31 N A -1.4444
32 V A -0.4122
33 G A -0.9475
34 S A -0.8206
35 N A -1.0431
36 T A 0.1390
37 Y A 1.5483
1 K B -3.3107
2 C B -2.1083
3 N B -1.7127
4 T B 0.0000
5 A B -0.0830
6 T B 0.0000
7 C B 0.6043
8 A B 0.0000
9 T B -0.7790
10 Q B 0.0000
11 R B -2.9855
12 L B 0.0000
13 A B -0.3897
14 N B 0.0000
15 F B 1.7509
16 L B 0.0000
17 V B -0.7666
18 R B -3.2431
19 S B -2.3283
20 S B 0.0000
21 N B -1.1056
22 N B 0.0000
23 L B 1.1805
24 G B 0.0000
25 P B 0.0000
26 V B 1.8018
27 L B 0.0000
28 P B 0.3341
29 P B -0.5807
30 T B 0.0000
31 N B -1.3913
32 V B 0.0000
33 G B -0.8855
34 S B 0.0000
35 N B -0.4859
36 T B 0.0000
37 Y B 1.9677
1 K C -3.1387
2 C C -1.9742
3 N C -1.4925
4 T C 0.0000
5 A C -0.0568
6 T C 0.0000
7 C C 0.5196
8 A C 0.0000
9 T C -1.0119
10 Q C 0.0000
11 R C -3.1844
12 L C 0.0000
13 A C 0.0000
14 N C 0.0000
15 F C 1.8120
16 L C 0.0000
17 V C -0.4799
18 R C -3.0226
19 S C -2.2245
20 S C 0.0000
21 N C -0.9949
22 N C 0.0000
23 L C 1.2250
24 G C 0.0000
25 P C 0.0000
26 V C 1.5606
27 L C 0.0000
28 P C 0.3332
29 P C -0.5608
30 T C 0.0000
31 N C -1.3575
32 V C 0.0000
33 G C -0.9049
34 S C 0.0000
35 N C -0.3771
36 T C 0.0000
37 Y C 1.8782
1 K D -2.4044
2 C D -1.3064
3 N D -1.1013
4 T D -0.4238
5 A D -0.0549
6 T D 0.1503
7 C D 0.4437
8 A D -0.0347
9 T D -0.9043
10 Q D -1.7139
11 R D -2.4862
12 L D -0.5792
13 A D 0.0590
14 N D 0.7811
15 F D 2.1643
16 L D 1.0329
17 V D 0.2563
18 R D -2.3182
19 S D -1.6129
20 S D -1.0669
21 N D -1.2389
22 N D 0.0697
23 L D 1.4093
24 G D 1.0202
25 P D 1.4014
26 V D 1.9325
27 L D 1.0599
28 P D 0.2603
29 P D -0.4528
30 T D -0.8547
31 N D -1.3938
32 V D -0.5020
33 G D -0.7534
34 S D -0.6322
35 N D -0.8250
36 T D 0.3045
37 Y D 1.5296
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018