Project name: obj1 [mutate: YD59C, YE95C, TY114C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	TY114C,YE95C,YD59C
Energy difference between WT (input) and mutated protein (by FoldX)	7.45314 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:25)

• Minimal score value: -3.2619
• Maximal score value: 1.9898
• Average score: -0.7055
• Total score value: -84.6554

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0068
2	V	C	-0.9429
3	Q	C	-1.2891
4	L	C	0.0000
5	V	C	0.6299
6	E	C	0.0000
7	S	C	-0.0453
8	G	C	-0.4870
9	G	C	0.3114
10	G	C	1.0599
11	L	C	1.4373
12	V	C	-0.0308
13	Q	C	-1.3366
14	P	C	-1.4885
15	G	C	-1.4134
16	G	C	-0.9789
17	S	C	-1.2324
18	L	C	-0.9310
19	R	C	-2.0966
20	L	C	0.0000
21	S	C	-0.3583
22	C	C	0.0000
23	A	C	-0.1615
24	A	C	0.0000
25	S	C	-0.2077
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2525
29	F	C	0.0000
30	R	C	-2.0331
31	S	C	-0.8871
32	Y	C	-1.2179
33	E	C	-1.0948
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.4637
40	A	C	-1.0343
41	P	C	-1.2942
42	G	C	-1.4571
43	K	C	-2.1828
44	G	C	-1.1586
45	L	C	0.1348
46	E	C	-0.5037
47	W	C	0.2169
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.8821
53	G	C	-1.2616
54	S	C	-1.2472
55	G	C	-1.1166
56	G	C	-0.7876
57	S	C	-0.9495
58	T	C	-1.0505
59	D	C	-1.8416	mutated: YD59C
60	Y	C	-1.5541
61	A	C	-1.6626
62	D	C	-2.6133
63	S	C	-1.7163
64	V	C	0.0000
65	K	C	-2.7259
66	G	C	-1.6185
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.9513
70	I	C	0.0000
71	S	C	-0.5745
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6492
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6280
81	L	C	0.0000
82	Q	C	-1.2341
83	M	C	0.0000
84	N	C	-1.3333
85	S	C	-1.2327
86	L	C	0.0000
87	R	C	-2.4721
88	A	C	-1.8893
89	E	C	-2.3445
90	D	C	0.0000
91	T	C	-0.4357
92	A	C	0.0000
93	I	C	1.1417
94	Y	C	0.0000
95	E	C	0.3221	mutated: YE95C
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1363
101	D	C	-3.2619
102	G	C	-1.9283
103	F	C	-1.2083
104	N	C	-2.2712
105	K	C	-3.0962
106	G	C	-1.8345
107	F	C	-0.9658
108	D	C	-1.1388
109	Y	C	-0.3032
110	W	C	0.2777
111	G	C	-0.1739
112	Q	C	-0.8421
113	G	C	0.2613
114	Y	C	1.1788	mutated: TY114C
115	L	C	1.9898
116	V	C	0.0000
117	T	C	0.3261
118	V	C	0.0000
119	S	C	-0.7746
120	S	C	-1.0601