Project name: 6620b062809d8a7

Chain sequence(s)	A: KNFHLRPRDLFSNINVILRELKGSETTEEIEYADETETQVELFNRWITKVQSDISTKT
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:32)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:32)

• Minimal score value: -2.9376
• Maximal score value: 1.6231
• Average score: -1.0033
• Total score value: -58.19

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	K	A	-1.8916
2	N	A	-1.3192
3	F	A	0.3308
4	H	A	-0.8759
5	L	A	-0.7380
6	R	A	-2.3349
7	P	A	-1.7987
8	R	A	-2.6503
9	D	A	-2.6671
10	L	A	-0.5141
11	F	A	0.7117
12	S	A	-0.0982
13	N	A	-0.2796
14	I	A	1.0179
15	N	A	0.5925
16	V	A	1.2744
17	I	A	1.2512
18	L	A	0.1878
19	R	A	-1.7217
20	E	A	-1.5265
21	L	A	-0.0844
22	K	A	-2.1380
23	G	A	-2.1134
24	S	A	-1.8673
25	E	A	-2.6837
26	T	A	-2.1992
27	T	A	-2.1136
28	E	A	-2.9376
29	E	A	-2.1443
30	I	A	0.1030
31	E	A	-1.3743
32	Y	A	-0.0121
33	A	A	-0.9357
34	D	A	-2.7747
35	E	A	-2.7805
36	T	A	-2.2035
37	E	A	-1.8426
38	T	A	-0.7806
39	Q	A	-0.2691
40	V	A	1.0683
41	E	A	-0.2099
42	L	A	0.6348
43	F	A	1.6231
44	N	A	-0.0664
45	R	A	-1.0505
46	W	A	0.4702
47	I	A	0.2207
48	T	A	-1.0276
49	K	A	-1.9758
50	V	A	-1.0484
51	Q	A	-1.6045
52	S	A	-1.7903
53	D	A	-2.4598
54	I	A	-1.0466
55	S	A	-1.2392
56	T	A	-1.4820
57	K	A	-2.0367
58	T	A	-0.9683