Project name: 6620b258b4dd51b

Status: done

Started: 2026-03-12 16:59:15
Settings
Chain sequence(s) A: MELKNSISDYTETEFKKIIEDIINCEGDEKKQDDNLEHFISVTEHPSGSDLIYYPEGNNDGSPEAVIKEIKEWRAANGKSGFKQG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:58)
Show buried residues

Minimal score value
-4.6973
Maximal score value
1.3179
Average score
-1.4395
Total score value
-122.3597

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A -1.4852
2 E A -2.0822
3 L A -1.0537
4 K A -1.7895
5 N A -2.1539
6 S A -1.6792
7 I A 0.0000
8 S A -1.8774
9 D A -2.5856
10 Y A 0.0000
11 T A -1.6915
12 E A -2.0140
13 T A -1.5954
14 E A -2.0429
15 F A 0.0000
16 K A -1.9132
17 K A -2.3146
18 I A 0.0000
19 I A 0.0000
20 E A -2.0893
21 D A 0.0000
22 I A 0.0000
23 I A -0.1584
24 N A -1.4552
25 C A -2.2631
26 E A -2.9221
27 G A -3.4932
28 D A -4.1034
29 E A -4.6973
30 K A -4.6410
31 K A -4.0412
32 Q A -3.8416
33 D A -4.4732
34 D A -3.9457
35 N A 0.0000
36 L A -1.7930
37 E A -2.2103
38 H A 0.0000
39 F A 0.0000
40 I A 0.2013
41 S A -0.8510
42 V A 0.0000
43 T A 0.0000
44 E A -1.5777
45 H A 0.0000
46 P A -0.6096
47 S A -0.3141
48 G A 0.0000
49 S A -0.0544
50 D A -0.3124
51 L A -0.1183
52 I A 0.6921
53 Y A 1.3179
54 Y A 1.0251
55 P A -0.7857
56 E A -2.1766
57 G A -2.1278
58 N A -2.2653
59 N A -2.5918
60 D A -2.9982
61 G A -1.6319
62 S A -1.5383
63 P A -1.9180
64 E A -2.7739
65 A A 0.0000
66 V A 0.0000
67 I A 0.0000
68 K A -2.6232
69 E A -2.0497
70 I A 0.0000
71 K A -2.0070
72 E A -2.5991
73 W A -1.7846
74 R A -1.8817
75 A A -1.3810
76 A A -1.1863
77 N A -1.5237
78 G A -1.3313
79 K A -1.5524
80 S A -1.2208
81 G A -1.7095
82 F A 0.0000
83 K A -2.3104
84 Q A -1.9510
85 G A -1.4331
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018