Project name: design8

Status: done

Started: 2026-05-21 07:40:35
Settings
Chain sequence(s) A: KAHHTNPAIVEAKIKALEALITYCLRKAEELRKEGKTEAAELLLRSAKLYAEAIKLIKAGEHEKAAELIYEANKLQLEVYKLENASEKVIEKMKEILETRKNGSIKERCKLYIELVKDLDPTFTPEEKQKISDALQQIIDAL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:18)
Show buried residues

Minimal score value
-5.205
Maximal score value
0.3624
Average score
-1.5978
Total score value
-226.8878

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 K A -1.8921
2 A A -0.8993
3 H A -0.7006
4 H A -1.8101
5 T A -1.2000
6 N A -0.8302
7 P A -1.0632
8 A A -0.7768
9 I A 0.0000
10 V A -1.3116
11 E A -1.9872
12 A A 0.0000
13 K A -1.1496
14 I A -1.4957
15 K A -1.9375
16 A A 0.0000
17 L A 0.0000
18 E A -1.5983
19 A A 0.0000
20 L A 0.0000
21 I A -0.4013
22 T A -0.0756
23 Y A 0.0000
24 C A 0.0000
25 L A -0.1602
26 R A -0.7672
27 K A 0.0000
28 A A 0.0000
29 E A -3.8124
30 E A -3.6740
31 L A 0.0000
32 R A -5.2050
33 K A -4.5843
34 E A -4.1984
35 G A -3.4961
36 K A -3.5856
37 T A -3.4272
38 E A -3.0933
39 A A 0.0000
40 A A 0.0000
41 E A -3.1331
42 L A -2.0706
43 L A 0.0000
44 L A -1.4909
45 R A -2.6432
46 S A 0.0000
47 A A 0.0000
48 K A -2.2236
49 L A -1.7630
50 Y A 0.0000
51 A A -1.7215
52 E A -2.4216
53 A A 0.0000
54 I A -2.1659
55 K A -2.8502
56 L A 0.0000
57 I A 0.0000
58 K A -3.0214
59 A A -1.9041
60 G A -2.3879
61 E A -3.4206
62 H A 0.0000
63 E A -3.3920
64 K A -3.3344
65 A A 0.0000
66 A A -2.2210
67 E A -2.8266
68 L A -2.1194
69 I A -1.4146
70 Y A -1.7116
71 E A -2.5787
72 A A 0.0000
73 N A 0.0000
74 K A -2.2247
75 L A -1.7568
76 Q A 0.0000
77 L A -1.8949
78 E A -2.6374
79 V A 0.0000
80 Y A 0.0000
81 K A -2.6773
82 L A -1.6398
83 E A -1.7720
84 N A -2.2559
85 A A -1.9351
86 S A -2.3114
87 E A -3.5306
88 K A -3.4880
89 V A 0.0000
90 I A -2.9585
91 E A -3.6102
92 K A -2.9480
93 M A 0.0000
94 K A -3.2060
95 E A -2.9930
96 I A 0.0000
97 L A 0.0000
98 E A -3.7837
99 T A 0.0000
100 R A -3.2532
101 K A -3.3623
102 N A -3.2138
103 G A -2.6130
104 S A -1.7768
105 I A -1.1877
106 K A -2.2641
107 E A -3.1668
108 R A -2.9012
109 C A 0.0000
110 K A -2.8343
111 L A -2.0938
112 Y A -1.5546
113 I A -2.2096
114 E A -2.6896
115 L A 0.0000
116 V A 0.0000
117 K A -3.0859
118 D A -3.0843
119 L A -2.0684
120 D A 0.0000
121 P A -0.8754
122 T A -0.3608
123 F A 0.0000
124 T A -1.2692
125 P A -2.0175
126 E A -2.8108
127 E A -2.3584
128 K A -2.8969
129 Q A -3.2917
130 K A -3.1739
131 I A 0.0000
132 S A 0.0000
133 D A -2.8084
134 A A 0.0000
135 L A 0.0000
136 Q A -2.1711
137 Q A -1.8098
138 I A 0.0000
139 I A 0.0000
140 D A -1.8242
141 A A -0.6507
142 L A 0.3624
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018