Project name: 66a22f6ecb8a334

Chain sequence(s)	A: GEEEDPSLQPLQDLLDSDIFEHSDGLGSGGGVGGGDLECDFEEIIRELLMDP
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:36)

• Minimal score value: -4.3144
• Maximal score value: 1.6215
• Average score: -0.9954
• Total score value: -51.7633

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	G	A	-2.1347
2	E	A	-3.7057
3	E	A	-4.2588
4	E	A	-4.3144
5	D	A	-3.5795
6	P	A	-2.0235
7	S	A	-1.0417
8	L	A	-0.8396
9	Q	A	-1.7936
10	P	A	-0.6911
11	L	A	0.3326
12	Q	A	-0.8818
13	D	A	-1.9300
14	L	A	0.3926
15	L	A	0.4902
16	D	A	-1.6207
17	S	A	-0.9400
18	D	A	-1.7109
19	I	A	0.4802
20	F	A	0.6665
21	E	A	-2.0593
22	H	A	-1.8270
23	S	A	-1.1060
24	D	A	-1.9894
25	G	A	-0.9729
26	L	A	0.5560
27	G	A	-0.4771
28	S	A	-0.5486
29	G	A	-0.5086
30	G	A	-0.6643
31	G	A	-0.1974
32	V	A	0.9221
33	G	A	-0.4001
34	G	A	-0.6606
35	G	A	-1.3310
36	D	A	-1.9703
37	L	A	-0.5341
38	E	A	-1.8994
39	C	A	-1.2995
40	D	A	-1.5555
41	F	A	-0.0705
42	E	A	-1.8477
43	E	A	-2.4976
44	I	A	0.1365
45	I	A	0.9971
46	R	A	-1.3095
47	E	A	-1.2350
48	L	A	1.1667
49	L	A	1.6215
50	M	A	0.4637
51	D	A	-1.2009
52	P	A	-0.3607