Project name: seq03

Status: error

Started: 2026-01-12 11:52:24
Settings
Chain sequence(s) A: GEEEDPSLQPLQDLLDSDIFEHSDGLGSGGGVGGGDLECDFEEIIRELLMDP
input PDB
Selected Chain(s) A
Distance of aggregation 5 Å
FoldX usage Yes
Dynamic mode Yes
Automated mutations No
Error log
One of Aggrescan3D modules (CABS) encountered an error. 
Traceback (most recent call last):
  File "/home/users/lcbio/mambaforge/lib/python3.10/runpy.py", line 189, in _run_module_as_main
    mod_name, mod_spec, code = _get_main_module_details(_Error)
  File "/home/users/lcbio/mambaforge/lib/python3.10/runpy.py", line 238, in _get_main_module_details
    return _get_module_details(main_name)
  File "/home/users/lcbio/mambaforge/lib/python3.10/runpy.py", line 157, in _get_module_details
    code = loader.get_code(mod_name)
  File "<frozen importlib._bootstrap_external>", line 1017, in get_code
  File "<frozen importlib._bootstrap_external>", line 947, in source_to_code
  File "<frozen importlib._bootstrap>", line 241, in _call_with_frames_removed
  File "/home/users/lcbio/anaconda2/envs/exec/lib/python2.7/site-packages/CABS/__main__.py", line 31
    print __version__
    ^^^^^^^^^^^^^^^^^
SyntaxError: Missing parentheses in call to 'print'. Did you mean print(...)?

Laboratory of Theory of Biopolymers 2018