Project name: 67288a2c8d32a77

Status: done

Started: 2026-06-14 09:53:00
Settings
Chain sequence(s) A: QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWFRQAPGQGLEAVAAISSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAADRAAGGRRVYEYNYWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:03)
Show buried residues

Minimal score value
-2.9536
Maximal score value
1.7361
Average score
-0.6335
Total score value
-77.2893

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.5487
2 V A -1.1269
3 Q A -1.1005
4 L A 0.0000
5 V A 1.1286
6 E A 0.5120
7 S A -0.0891
8 G A -0.8409
9 G A 0.1261
10 G A 0.6846
11 L A 1.4268
12 V A -0.1081
13 Q A -1.4479
14 P A -1.8138
15 G A -1.5478
16 G A -1.0154
17 S A -1.2878
18 L A -0.8966
19 R A -2.1228
20 L A 0.0000
21 S A -0.3887
22 C A 0.0000
23 A A -0.1386
24 A A 0.0000
25 S A -0.9429
26 G A -1.0679
27 F A -0.6488
28 T A -0.5166
29 F A 0.0000
30 S A -0.9677
31 S A -0.7884
32 Y A 0.0000
33 A A 0.0000
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A 0.3945
38 R A 0.0000
39 Q A -0.4054
40 A A -0.8624
41 P A -0.9678
42 G A -1.2206
43 Q A -1.6834
44 G A -0.8985
45 L A 0.3102
46 E A -0.3807
47 A A 0.1582
48 V A 0.0000
49 A A 0.0000
50 A A 0.3312
51 I A 0.0000
52 S A -0.5997
53 S A -0.9534
54 G A -0.8030
55 G A -0.6734
56 S A -0.3494
57 T A 0.2222
58 Y A 0.6572
59 Y A -0.3143
60 A A 0.0000
61 D A -2.3611
62 S A -1.7680
63 V A 0.0000
64 K A -2.4742
65 G A -1.7645
66 R A -1.7328
67 F A 0.0000
68 T A -0.7361
69 I A 0.0000
70 S A -0.4640
71 R A -1.2739
72 D A -2.0053
73 N A -2.2046
74 S A -1.8717
75 K A -2.5884
76 N A -1.9765
77 T A 0.0000
78 L A 0.0000
79 Y A -0.6581
80 L A 0.0000
81 Q A -1.2881
82 M A 0.0000
83 N A -1.5465
84 S A -1.4438
85 L A 0.0000
86 R A -2.9536
87 A A -2.0278
88 E A -2.4595
89 D A 0.0000
90 T A -0.4852
91 A A 0.0000
92 V A 0.9549
93 Y A 0.0000
94 Y A 0.5354
95 C A 0.0000
96 A A 0.0000
97 A A 0.0000
98 D A -1.2778
99 R A -2.2704
100 A A -1.5065
101 A A -1.6981
102 G A -1.5790
103 G A -1.7936
104 R A -2.4763
105 R A -1.9402
106 V A 0.3063
107 Y A 0.1026
108 E A -1.7522
109 Y A -0.9198
110 N A -1.6226
111 Y A -0.6490
112 W A 0.2035
113 G A -0.0033
114 Q A -0.8231
115 G A 0.1564
116 T A 0.6408
117 L A 1.7361
118 V A 0.0000
119 T A 0.3163
120 V A 0.0000
121 S A -0.7783
122 S A -0.5014
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018