Project name: jn1rbd

Status: done

Started: 2026-05-07 11:59:18
Settings
Chain sequence(s) A: WSEEEEWELAMKLHELMWKLYHEARKTVPNPDTEEGHYKVHEIAMTKFIPESRKLKEEMA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:09)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:09)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:09)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:09)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:09)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:54)
Show buried residues

Minimal score value
-4.1663
Maximal score value
0.0724
Average score
-1.8625
Total score value
-111.7519

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 W A -0.5017
2 S A -1.9591
3 E A -3.4266
4 E A -3.7110
5 E A -3.4123
6 E A -3.3972
7 W A -1.7393
8 E A -2.4719
9 L A 0.0000
10 A A -1.3371
11 M A -0.9427
12 K A -1.6985
13 L A -0.9401
14 H A -1.4214
15 E A -1.9763
16 L A -1.2084
17 M A -0.7384
18 W A -0.7525
19 K A -2.1040
20 L A 0.0000
21 Y A -1.6355
22 H A -2.5110
23 E A -2.7877
24 A A 0.0000
25 R A -3.1308
26 K A -2.9522
27 T A -1.8491
28 V A 0.0000
29 P A -2.0645
30 N A -2.9621
31 P A -3.1214
32 D A -3.1977
33 T A -2.7648
34 E A -3.3561
35 E A -3.3069
36 G A 0.0000
37 H A -2.7464
38 Y A -1.2956
39 K A -2.3369
40 V A 0.0000
41 H A -1.5030
42 E A -2.0067
43 I A -0.9595
44 A A 0.0000
45 M A -0.2410
46 T A -0.4685
47 K A -0.6426
48 F A -0.1890
49 I A 0.0724
50 P A -1.1986
51 E A -2.0935
52 S A 0.0000
53 R A -3.7108
54 K A -4.1365
55 L A -3.1673
56 K A -4.0330
57 E A -4.1663
58 E A -3.5725
59 M A -2.2142
60 A A -1.7641
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018