Project name: CT-Chimera-Fusion

Chain sequence(s)	A: CGNLSTCLLGTYTQDAHKLQTYPRTNTGSGTPGGGGSGGGGSGRKKRRQRRRPPQGGGGSGGGGSLAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALP
Selected Chain(s)	A
Distance of aggregation	5 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:25)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:26)

• Minimal score value: -2.5392
• Maximal score value: 1.9663
• Average score: -0.5234
• Total score value: -58.1026

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	C	A	0.6151
2	G	A	-0.5130
3	N	A	-1.0611
4	L	A	1.2667
5	S	A	0.0439
6	T	A	0.0144
7	C	A	1.0041
8	L	A	1.9663
9	L	A	1.7435
10	G	A	-0.1881
11	T	A	0.1100
12	Y	A	1.2850
13	T	A	0.0175
14	Q	A	-1.5244
15	D	A	-1.9890
16	A	A	-0.4358
17	H	A	-1.2834
18	K	A	-1.5970
19	L	A	1.0238
20	Q	A	-0.7974
21	T	A	-0.0657
22	Y	A	1.1335
23	P	A	-0.3498
24	R	A	-1.9032
25	T	A	-0.6499
26	N	A	-1.2991
27	T	A	-0.3885
28	G	A	-0.5174
29	S	A	-0.3786
30	G	A	-0.5195
31	T	A	-0.2176
32	P	A	-0.3520
33	G	A	-0.6005
34	G	A	-0.6505
35	G	A	-0.6584
36	G	A	-0.6059
37	S	A	-0.4000
38	G	A	-0.5997
39	G	A	-0.6708
40	G	A	-0.6622
41	G	A	-0.5882
42	S	A	-0.3821
43	G	A	-0.8438
44	R	A	-2.2474
45	K	A	-2.3630
46	K	A	-2.3558
47	R	A	-2.5392
48	R	A	-2.4599
49	Q	A	-1.9137
50	R	A	-2.4217
51	R	A	-2.5297
52	R	A	-2.2228
53	P	A	-0.5902
54	P	A	-0.5100
55	Q	A	-1.3022
56	G	A	-0.6181
57	G	A	-0.6069
58	G	A	-0.6551
59	G	A	-0.6108
60	S	A	-0.3852
61	G	A	-0.5905
62	G	A	-0.6372
63	G	A	-0.6378
64	G	A	-0.5780
65	S	A	-0.1602
66	L	A	0.4179
67	A	A	0.0388
68	E	A	-0.4843
69	A	A	0.0000
70	K	A	-0.1387
71	V	A	0.8204
72	L	A	1.6529
73	A	A	0.0000
74	N	A	-0.3701
75	R	A	-1.2367
76	E	A	-1.2051
77	L	A	0.0000
78	D	A	-1.2547
79	K	A	-1.6537
80	Y	A	0.7369
81	G	A	-0.3244
82	V	A	0.0695
83	S	A	-0.5014
84	D	A	-1.6154
85	Y	A	1.0756
86	Y	A	0.6915
87	K	A	-0.5522
88	N	A	-1.3585
89	L	A	0.2943
90	I	A	0.0000
91	N	A	-1.6312
92	N	A	-1.4984
93	A	A	-0.5255
94	K	A	-1.7094
95	T	A	-0.2717
96	V	A	0.2075
97	E	A	-1.7553
98	G	A	-0.4786
99	V	A	0.0000
100	K	A	-1.0079
101	A	A	-0.2608
102	L	A	0.3952
103	I	A	-0.0482
104	D	A	-2.0328
105	E	A	-2.1369
106	I	A	0.0000
107	L	A	0.2039
108	A	A	0.1361
109	A	A	0.1784
110	L	A	0.5808
111	P	A	-0.1462