Project name: 679899c22f05173

Status: done

Started: 2026-05-19 11:04:00
Settings
Chain sequence(s) A: QVQLLESGGGLVQPGGSLRLSCAASGGTFTNYKMGWFRQAPGKGREFVAHITWSGASTDYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCVAKYWRNEGYLSDYPYWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:08)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:08)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:08)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:08)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:08)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:42)
Show buried residues

Minimal score value
-2.8301
Maximal score value
0.9158
Average score
-0.7753
Total score value
-95.3599

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.4862
2 V A -0.9784
3 Q A -0.9686
4 L A 0.0000
5 L A 0.4159
6 E A -0.2577
7 S A -0.6920
8 G A -1.0414
9 G A -0.8444
10 G A -0.0937
11 L A 0.9158
12 V A 0.0000
13 Q A -1.3362
14 P A -1.4967
15 G A -1.3364
16 G A -0.9507
17 S A -1.3039
18 L A -1.0556
19 R A -2.1383
20 L A 0.0000
21 S A -0.5674
22 C A 0.0000
23 A A -0.3005
24 A A -0.5296
25 S A -0.7385
26 G A -1.1838
27 G A -0.8740
28 T A -0.4205
29 F A 0.0000
30 T A -0.3891
31 N A -0.3869
32 Y A 0.0000
33 K A -0.4161
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A 0.0000
38 R A 0.0000
39 Q A -1.7828
40 A A -1.7335
41 P A -1.2294
42 G A -1.6962
43 K A -2.6947
44 G A -2.3812
45 R A -2.4824
46 E A -1.4876
47 F A -0.5176
48 V A 0.0000
49 A A 0.0000
50 H A -0.5274
51 I A 0.0000
52 T A -0.3721
53 W A -0.1432
54 S A -0.3441
55 G A -0.4751
56 A A -0.1392
57 S A -0.5528
58 T A -0.9158
59 D A -1.8219
60 Y A -1.5682
61 A A -1.5887
62 D A -2.6190
63 S A -1.7026
64 V A 0.0000
65 K A -2.8301
66 G A -1.7854
67 R A -1.5875
68 F A 0.0000
69 T A -1.0439
70 I A 0.0000
71 S A -0.4228
72 R A -0.8867
73 D A -1.4443
74 N A -1.4839
75 A A -1.3048
76 K A -2.2070
77 N A -1.6340
78 T A -0.9947
79 L A 0.0000
80 Y A -0.5694
81 L A 0.0000
82 Q A -1.2602
83 M A 0.0000
84 N A -1.5081
85 S A -1.2030
86 L A 0.0000
87 R A -2.0617
88 A A -1.6031
89 E A -2.1595
90 D A 0.0000
91 T A -0.8154
92 A A 0.0000
93 V A -0.4823
94 Y A 0.0000
95 Y A -0.3527
96 C A 0.0000
97 V A 0.0000
98 A A 0.0000
99 K A 0.0000
100 Y A -0.4986
101 W A -1.0225
102 R A -2.5776
103 N A -2.6551
104 E A -2.6956
105 G A -1.3164
106 Y A 0.4653
107 L A 0.2764
108 S A -0.3073
109 D A -1.0457
110 Y A 0.0000
111 P A -0.1679
112 Y A 0.1249
113 W A 0.1644
114 G A -0.2831
115 Q A -1.0086
116 G A -0.6759
117 T A -0.8056
118 Q A -0.9881
119 V A 0.0000
120 T A -0.2835
121 V A 0.0000
122 S A -0.6915
123 S A -0.4970
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018