Project name: 67c0e3d63beb2e0

Chain sequence(s)	A: QTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:53)

• Minimal score value: -2.9134
• Maximal score value: 2.2741
• Average score: -0.444
• Total score value: -55.5029

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
244	Q	A	-0.7648
245	T	A	0.0000
246	A	A	-0.2245
247	P	A	0.1430
248	V	A	1.2291
249	P	A	0.3243
250	M	A	0.0780
251	P	A	-0.1451
252	D	A	-0.4401
253	L	A	0.3215
254	K	A	-1.1077
255	N	A	-0.7762
256	V	A	0.0521
257	K	A	-1.5748
258	S	A	0.0000
259	K	A	-0.2289
260	I	A	0.1703
261	G	A	-0.2963
262	S	A	-0.3761
263	T	A	0.0000
264	E	A	-0.6170
265	N	A	0.0000
266	L	A	-0.6160
267	K	A	-0.5979
268	H	A	-0.8222
269	Q	A	-1.6069
270	P	A	-1.7778
271	G	A	0.0000
272	G	A	0.0000
273	G	A	-2.3247
274	K	A	-2.5934
275	V	A	1.6530
276	Q	A	0.8165
277	I	A	2.2741
278	I	A	1.5108
279	N	A	-1.0438
280	K	A	-1.2920
281	K	A	-1.3598
282	L	A	0.2700
283	D	A	-1.0810
284	L	A	-0.1174
285	S	A	0.0000
286	N	A	0.0000
287	V	A	0.8016
288	Q	A	-0.7427
289	S	A	0.0000
290	K	A	-1.0994
291	C	A	-0.2911
292	G	A	-1.0001
293	S	A	-1.3256
294	K	A	-2.4798
295	D	A	-2.7929
296	N	A	-2.4021
297	I	A	-1.6270
298	K	A	-1.7422
299	H	A	-0.8810
300	V	A	0.5395
301	P	A	0.0954
302	G	A	0.0000
303	G	A	0.0000
304	G	A	0.0000
305	S	A	-1.0204
275	V	A	2.1623
276	Q	A	0.5355
277	I	A	1.5997
278	I	A	0.9853
279	N	A	-1.0287
280	K	A	-0.9972
281	K	A	-0.9915
282	L	A	1.1834
283	D	A	0.0000
284	L	A	1.7622
285	S	A	0.7962
286	N	A	-0.3808
287	V	A	0.5200
288	Q	A	0.0000
289	S	A	0.0000
290	K	A	-0.6650
291	C	A	-0.1092
292	G	A	-0.8770
293	S	A	-1.0913
294	K	A	-1.6545
295	D	A	-1.4176
296	N	A	0.0000
297	I	A	0.7177
298	K	A	-0.0155
299	H	A	0.0000
300	V	A	1.1637
301	P	A	0.0000
302	G	A	0.0000
303	G	A	0.0000
304	G	A	0.0000
305	S	A	-0.5638
337	V	A	0.0000
338	E	A	-0.7443
339	V	A	0.3847
340	K	A	-1.2187
341	S	A	-1.3879
342	E	A	-1.8406
343	K	A	-1.8196
344	L	A	-0.7531
345	D	A	-1.3528
346	F	A	0.2323
347	K	A	-1.9101
348	D	A	-2.9134
349	R	A	-2.6593
350	V	A	-0.7872
351	Q	A	-1.7645
352	S	A	-1.6848
353	K	A	-1.6045
354	I	A	-0.7361
355	G	A	-0.5175
356	S	A	-0.6005
357	L	A	-0.4683
358	D	A	-1.6554
359	N	A	-1.3352
360	I	A	-0.5915
361	T	A	0.0000
362	H	A	0.0000
363	V	A	0.4094
364	P	A	0.1831
365	G	A	0.0000
366	G	A	0.0000
367	G	A	0.0000
368	N	A	-1.0915