Project name: query_structure

Status: done

Started: 2026-03-17 01:02:54
Settings
Chain sequence(s) A: SNLSTAVLGKLSQELHKLQTYPRTDVGAGTP
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:20)
Show buried residues

Minimal score value
-2.4914
Maximal score value
1.124
Average score
-0.6023
Total score value
-18.6724

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S A -0.3892
2 N A -0.6027
3 L A 1.1240
4 S A 0.5246
5 T A 0.3631
6 A A 0.3908
7 V A 0.6381
8 L A 0.7537
9 G A -0.6796
10 K A -1.7368
11 L A -0.5796
12 S A -0.9604
13 Q A -2.4914
14 E A -2.2095
15 L A -0.4020
16 H A -1.7657
17 K A -1.5944
18 L A 0.0707
19 Q A -1.1419
20 T A -0.8013
21 Y A 0.1505
22 P A -0.8814
23 R A -1.9112
24 T A -1.2171
25 D A -1.7572
26 V A 0.1355
27 G A -0.4707
28 A A -0.0986
29 G A -0.4091
30 T A -0.3268
31 P A -0.3968
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018