Project name: 681fc02c944289

Chain sequence(s)	A: LGVPTLAHAPAVVAAPIAVKAAVPIATSYQNSQLISTGAVAVAAPTVVKAAPIAVAAPVAAAPILSAPLVHSVAAAPVVHSVAAAPVYKAW
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:20)

• Minimal score value: -1.4774
• Maximal score value: 2.6333
• Average score: 1.0755
• Total score value: 97.8681

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
19	L	A	1.6419
20	G	A	1.0647
21	V	A	1.9217
22	P	A	1.1570
23	T	A	0.8663
24	L	A	1.4404
25	A	A	0.2391
26	H	A	-0.5834
27	A	A	0.0931
28	P	A	0.2378
29	A	A	1.1684
30	V	A	2.6312
31	V	A	2.6333
32	A	A	1.7309
33	A	A	1.1467
34	P	A	1.2659
35	I	A	2.2120
36	A	A	1.3548
37	V	A	1.5439
38	K	A	-0.2439
39	A	A	0.2738
40	A	A	1.0022
41	V	A	2.0390
42	P	A	1.6130
43	I	A	2.3711
44	A	A	1.2635
45	T	A	0.5526
46	S	A	0.1507
47	Y	A	0.2290
48	Q	A	-1.0495
49	N	A	-1.4774
50	S	A	-0.8799
51	Q	A	-0.6214
52	L	A	1.4683
53	I	A	1.8641
54	S	A	0.8864
55	T	A	0.6845
56	G	A	0.2207
57	A	A	0.9099
58	V	A	2.2003
59	A	A	1.7650
60	V	A	2.3165
61	A	A	1.1077
62	A	A	0.6521
63	P	A	0.7243
64	T	A	0.9639
65	V	A	2.0720
66	V	A	1.7781
67	K	A	-0.3449
68	A	A	0.2158
69	A	A	0.2565
70	P	A	0.7904
71	I	A	2.4299
72	A	A	1.8578
73	V	A	2.3304
74	A	A	1.4350
75	A	A	0.9464
76	P	A	0.8757
77	V	A	1.7295
78	A	A	0.8868
79	A	A	0.7483
80	A	A	0.7624
81	P	A	1.0875
82	I	A	2.6229
83	L	A	2.3783
84	S	A	1.0769
85	A	A	0.8894
86	P	A	0.7975
87	L	A	1.9917
88	V	A	2.1171
89	H	A	0.5762
90	S	A	0.8133
91	V	A	1.6618
92	A	A	0.7620
93	A	A	0.6859
94	A	A	0.8353
95	P	A	1.0135
96	V	A	2.2556
97	V	A	2.2269
98	H	A	0.6395
99	S	A	0.8603
100	V	A	1.6659
101	A	A	0.7641
102	A	A	0.7132
103	A	A	0.7915
104	P	A	0.8043
105	V	A	1.8719
106	Y	A	1.4418
107	K	A	-0.3085
108	A	A	0.3659
109	W	A	0.9441