Project name: KFDV_C

Status: done

Started: 2026-05-19 17:46:53
Settings
Chain sequence(s) A: MAKGAVLKGKGGGPPRRVPKETAKKTRQGPGRLPNGLVLMRMMGVLWHMVAGTARNPILKRFWATVPVRQAIAALRKIRKTVGLLLDSLNKRRGKRRSTTGLLTPILLACLATLVFS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:22)
Show buried residues

Minimal score value
-4.9976
Maximal score value
3.7291
Average score
-0.5623
Total score value
-65.7949

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.6319
2 A A -0.3664
3 K A -1.4150
4 G A -0.4711
5 A A 0.4431
6 V A 1.6834
7 L A 1.1709
8 K A -1.1899
9 G A -1.6373
10 K A -2.5516
11 G A -2.0527
12 G A -1.4921
13 G A -1.4287
14 P A -1.4886
15 P A -1.6810
16 R A -2.5128
17 R A -2.3196
18 V A -0.5702
19 P A -1.5071
20 K A -2.7277
21 E A -3.1881
22 T A -2.4172
23 A A -2.6244
24 K A -3.9080
25 K A -3.4937
26 T A -2.6682
27 R A -3.5262
28 Q A -3.3209
29 G A -2.2523
30 P A -1.6779
31 G A -1.7646
32 R A -2.6252
33 L A -1.4144
34 P A -1.2642
35 N A -1.4523
36 G A -0.6411
37 L A 0.0069
38 V A 0.0000
39 L A 0.2981
40 M A 0.5645
41 R A -0.2977
42 M A 0.0000
43 M A 1.0134
44 G A 0.8813
45 V A 0.0000
46 L A 1.9382
47 W A 2.0266
48 H A 1.0875
49 M A 1.7372
50 V A 2.3831
51 A A 1.1490
52 G A 0.1119
53 T A -0.3792
54 A A -0.9920
55 R A -2.0069
56 N A -1.3315
57 P A -1.2088
58 I A -0.6960
59 L A -0.6779
60 K A -2.0291
61 R A -2.0742
62 F A 0.0000
63 W A 0.4700
64 A A -0.2479
65 T A -0.2308
66 V A 0.0000
67 P A -0.1125
68 V A 0.7365
69 R A -1.0087
70 Q A -1.0291
71 A A 0.0000
72 I A 0.1904
73 A A -0.7925
74 A A 0.0000
75 L A -0.6540
76 R A -2.7313
77 K A -2.8295
78 I A -1.2037
79 R A -2.4580
80 K A -2.4487
81 T A -0.7760
82 V A -0.0910
83 G A -0.2707
84 L A 1.0292
85 L A 1.1519
86 L A -0.0365
87 D A -1.8453
88 S A -1.3668
89 L A -1.6698
90 N A -3.5250
91 K A -4.2490
92 R A -4.3371
93 R A -4.9976
94 G A -4.0900
95 K A -4.3640
96 R A -4.1449
97 R A -3.6154
98 S A -1.9794
99 T A -0.3739
100 T A 0.1087
101 G A 0.5433
102 L A 2.5420
103 L A 3.1426
104 T A 2.2472
105 P A 2.4400
106 I A 3.7291
107 L A 3.2403
108 L A 3.0666
109 A A 2.5694
110 C A 2.5875
111 L A 2.9807
112 A A 2.7008
113 T A 2.4705
114 L A 3.4079
115 V A 3.6598
116 F A 3.2030
117 S A 1.6836
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018