Project name: 68c30da5704a40d

Status: done

Started: 2026-05-14 07:07:28
Settings
Chain sequence(s) A: MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKPIENERMQRARFMRQSNFGTIGQTPETSLAQTESSKKGELFALRFLPILPKSLNAKTLDKVSNTKLTVSKVKGKFDAAGPGPGGDLPVTFWEGQGVGLGPGPGCGDLPVTFWEGQGVGAAYKVKVSVTTLGPGPGQSMPVHLRF
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:51)
Show buried residues

Minimal score value
-4.068
Maximal score value
5.6436
Average score
-0.0342
Total score value
-7.2465

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.3895
2 R A 0.5319
3 V A 2.7212
4 L A 3.2328
5 Y A 3.2278
6 L A 3.5483
7 L A 4.2112
8 F A 4.5979
9 S A 4.4402
10 F A 5.3363
11 L A 5.3095
12 F A 5.6247
13 I A 5.6436
14 F A 5.3889
15 L A 4.5989
16 M A 3.3461
17 P A 2.4042
18 L A 2.5674
19 P A 0.8571
20 G A 0.9015
21 V A 2.4466
22 F A 2.4222
23 G A 0.7196
24 G A 0.2222
25 I A 0.1308
26 G A -0.2990
27 D A -0.2269
28 P A 0.6772
29 V A 1.4863
30 T A 0.3064
31 C A 0.0000
32 L A 1.2500
33 K A -0.5848
34 S A -0.2481
35 G A -0.7388
36 A A 0.0000
37 I A 0.4344
38 C A 0.8711
39 H A 0.3132
40 P A 0.8783
41 V A 1.9585
42 F A 1.6246
43 C A -0.4709
44 P A -1.4821
45 R A -2.8536
46 R A -3.4059
47 Y A -2.8548
48 K A -3.0187
49 Q A -1.7503
50 I A -0.7996
51 G A -0.9175
52 T A -0.6690
53 C A 0.0000
54 G A -0.1566
55 L A 0.7617
56 P A 0.2492
57 G A 0.3056
58 T A 0.3678
59 K A -0.3800
60 C A 0.0000
61 C A 0.0000
62 K A -2.2399
63 K A -3.4923
64 P A -2.7333
65 E A -2.6497
66 A A -1.6437
67 A A -0.9979
68 K A -1.8160
69 P A -0.7372
70 I A 0.1643
71 E A -2.3621
72 N A -2.6867
73 E A -4.0680
74 R A -3.9700
75 M A -2.5338
76 Q A -3.6853
77 R A -3.4757
78 A A -2.3997
79 R A -2.8003
80 F A -0.8949
81 M A -0.9743
82 R A -2.5359
83 Q A -1.7892
84 S A -1.0017
85 N A -0.8889
86 F A 0.6592
87 G A -0.0177
88 T A 0.6319
89 I A 1.5097
90 G A -0.0164
91 Q A -1.0659
92 T A -1.1427
93 P A -1.4886
94 E A -2.0418
95 T A -0.8423
96 S A 0.1944
97 L A 1.2069
98 A A -0.0004
99 Q A -1.3792
100 T A -1.7238
101 E A -2.5034
102 S A -2.0356
103 S A -2.0995
104 K A -3.3000
105 K A -3.1515
106 G A -2.0408
107 E A -1.4787
108 L A 1.4718
109 F A 2.3664
110 A A 1.6801
111 L A 2.1267
112 R A 0.5164
113 F A 2.3956
114 L A 2.7680
115 P A 2.1854
116 I A 3.0098
117 L A 2.0387
118 P A 0.2766
119 K A -1.0784
120 S A -0.4504
121 L A 0.2200
122 N A -1.0300
123 A A -0.9140
124 K A -1.7548
125 T A -0.9290
126 L A -0.0230
127 D A -1.7480
128 K A -1.5160
129 V A 0.3001
130 S A -0.9485
131 N A -1.4223
132 T A -0.7827
133 K A -1.0350
134 L A 1.3549
135 T A 1.1845
136 V A 1.7908
137 S A 0.3655
138 K A -1.2195
139 V A -0.6497
140 K A -2.3650
141 G A -2.0093
142 K A -2.2670
143 F A -0.3588
144 D A -1.4061
145 A A -0.5441
146 A A -0.4604
147 G A -0.9288
148 P A -0.7958
149 G A -0.9950
150 P A -1.1076
151 G A -1.2440
152 G A -1.0736
153 D A -1.2899
154 L A 0.7001
155 P A 0.8916
156 V A 2.1687
157 T A 1.7982
158 F A 2.3085
159 W A 1.1125
160 E A -1.3622
161 G A -1.2935
162 Q A -1.5850
163 G A -0.3637
164 V A 1.2917
165 G A 0.6956
166 L A 1.4018
167 G A 0.0995
168 P A -0.4004
169 G A -0.7059
170 P A -0.7038
171 G A -0.7685
172 C A -0.1096
173 G A -0.7737
174 D A -0.9365
175 L A 0.9712
176 P A 1.0465
177 V A 2.4715
178 T A 1.9499
179 F A 2.3923
180 W A 1.1528
181 E A -1.3525
182 G A -1.2926
183 Q A -1.6280
184 G A -0.7154
185 V A 0.9887
186 G A 0.3288
187 A A 0.3862
188 A A 0.4385
189 Y A 0.4247
190 K A -1.5048
191 V A -0.9263
192 K A -2.1289
193 V A -0.3509
194 S A 0.4597
195 V A 2.1364
196 T A 1.2960
197 T A 0.8648
198 L A 1.0804
199 G A -0.3119
200 P A -0.4966
201 G A -0.9087
202 P A -0.9774
203 G A -1.0672
204 Q A -1.0578
205 S A -0.1056
206 M A 0.8446
207 P A 0.2119
208 V A 0.2827
209 H A -1.0940
210 L A -0.4301
211 R A -1.0371
212 F A 1.1320
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018