Project name: 69002718289b8a0

Status: done

Started: 2026-06-22 16:06:14
Settings
Chain sequence(s) B: LAHMEEMRKRMEEAKRIMLQMAELASPEVVKKAEEFAKEMDERFEKMEAA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:32)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:32)
Show buried residues

Minimal score value
-5.0739
Maximal score value
0.8548
Average score
-2.2846
Total score value
-114.2286

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L B 0.5352
2 A B -0.6096
3 H B -1.6347
4 M B -1.9499
5 E B -3.3915
6 E B -3.5273
7 M B -3.2203
8 R B -4.7687
9 K B -4.9524
10 R B -4.6957
11 M B -3.5147
12 E B -4.0130
13 E B -3.8516
14 A B -2.2297
15 K B -2.2842
16 R B -2.3940
17 I B -0.0271
18 M B 0.0130
19 L B -0.6483
20 Q B -0.5571
21 M B 0.6872
22 A B 0.0000
23 E B -1.1461
24 L B 0.8548
25 A B 0.1737
26 S B -0.8942
27 P B -1.7517
28 E B -2.9675
29 V B -1.8213
30 V B -2.1783
31 K B -3.7397
32 K B -3.4233
33 A B 0.0000
34 E B -3.5001
35 E B -3.3977
36 F B -1.3993
37 A B 0.0000
38 K B -3.9810
39 E B -3.6731
40 M B -3.2414
41 D B -4.4903
42 E B -5.0739
43 R B -4.8378
44 F B 0.0000
45 E B -4.7759
46 K B -3.9940
47 M B -2.3805
48 E B -2.9372
49 A B -1.7272
50 A B -0.8912
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018