Project name: obj1 [mutate: LA45C, YD59C, IF93C, GM113C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	IF93C,LA45C,GM113C,YD59C
Energy difference between WT (input) and mutated protein (by FoldX)	7.32635 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:26)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:58)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:22)

• Minimal score value: -3.2747
• Maximal score value: 1.5458
• Average score: -0.7527
• Total score value: -90.3253

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0068
2	V	C	-0.9129
3	Q	C	-1.2386
4	L	C	0.0000
5	V	C	0.6693
6	E	C	0.2963
7	S	C	-0.4107
8	G	C	-0.9130
9	G	C	-0.1380
10	G	C	0.7381
11	L	C	1.3431
12	V	C	-0.0358
13	Q	C	-1.3366
14	P	C	-1.4884
15	G	C	-1.4134
16	G	C	-0.9785
17	S	C	-1.2309
18	L	C	-0.9619
19	R	C	-2.1461
20	L	C	0.0000
21	S	C	-0.5418
22	C	C	0.0000
23	A	C	-0.2021
24	A	C	0.0000
25	S	C	-0.2017
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2524
29	F	C	0.0000
30	R	C	-2.0310
31	S	C	-0.8844
32	Y	C	-1.2103
33	E	C	-1.0974
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.9711
40	A	C	-1.3772
41	P	C	-1.3250
42	G	C	-1.5908
43	K	C	-2.4668
44	G	C	-1.7452
45	A	C	-1.0091	mutated: LA45C
46	E	C	-1.0889
47	W	C	-0.0198
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.8656
53	G	C	-1.2574
54	S	C	-1.2456
55	G	C	-1.1153
56	G	C	-0.7881
57	S	C	-0.9066
58	T	C	-0.9571
59	D	C	-1.6601	mutated: YD59C
60	Y	C	-1.4629
61	A	C	-1.6239
62	D	C	-2.5925
63	S	C	-1.7164
64	V	C	0.0000
65	K	C	-2.6995
66	G	C	-1.6187
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.9300
70	I	C	0.0000
71	S	C	-0.5748
72	R	C	-1.3628
73	D	C	-1.9805
74	N	C	-2.1902
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6491
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6694
81	L	C	0.0000
82	Q	C	-1.2335
83	M	C	0.0000
84	N	C	-1.3326
85	S	C	-1.2322
86	L	C	0.0000
87	R	C	-2.4717
88	A	C	-1.8887
89	E	C	-2.3440
90	D	C	0.0000
91	T	C	-0.5604
92	A	C	0.0000
93	F	C	0.7166	mutated: IF93C
94	Y	C	0.0000
95	Y	C	0.5790
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1445
101	D	C	-3.2747
102	G	C	-1.9615
103	F	C	-1.2681
104	N	C	-2.3116
105	K	C	-3.1167
106	G	C	-1.8486
107	F	C	-0.9260
108	D	C	-1.0863
109	Y	C	-0.1892
110	W	C	0.6770
111	G	C	0.1143
112	Q	C	-0.6108
113	M	C	0.4795	mutated: GM113C
114	T	C	0.5030
115	L	C	1.1689
116	V	C	0.0000
117	T	C	0.1740
118	V	C	0.0000
119	S	C	-0.7741
120	S	C	-1.0599