Project name: query_structure

Status: done

Started: 2026-03-17 01:20:47
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYFITYGETGYPGPPQEFTVPGSKSTATISGLKPGVDYTITVYAWAYYERLSPISIYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:42)
Show buried residues

Minimal score value
-2.3868
Maximal score value
1.7662
Average score
-0.3752
Total score value
-33.3911

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7662
2 S A 0.7537
3 S A 0.3258
4 V A 0.3059
5 P A 0.0000
6 T A -1.3349
7 K A -2.3868
8 L A 0.0000
9 E A -1.7628
10 V A -0.0136
11 V A 1.5547
12 A A 0.9381
13 A A 0.5787
14 T A -0.3475
15 P A -0.8449
16 T A -0.9481
17 S A -0.4625
18 L A 0.5442
19 L A 0.8304
20 I A 0.0000
21 S A -0.7789
22 W A 0.0000
23 D A -1.7930
24 A A -0.8649
25 P A 0.1759
26 A A 0.4712
27 V A 0.5646
28 T A -0.0061
29 V A 0.0000
30 D A -1.1579
31 F A -0.2973
32 Y A 0.0000
33 F A 0.0746
34 I A 0.0000
35 T A 0.0000
36 Y A 0.0000
37 G A -1.0107
38 E A -1.0818
39 T A -0.4046
40 G A -0.1350
41 Y A 0.5507
42 P A 0.0020
43 G A -0.2978
44 P A -0.8859
45 P A -1.4245
46 Q A -2.1571
47 E A -2.1419
48 F A -0.5354
49 T A 0.1275
50 V A 0.0000
51 P A -0.8055
52 G A -0.9946
53 S A -1.2548
54 K A -1.9517
55 S A -1.1103
56 T A -0.6365
57 A A 0.0000
58 T A 0.2898
59 I A 0.0000
60 S A -0.6273
61 G A -1.0218
62 L A 0.0000
63 K A -2.1060
64 P A -1.2938
65 G A -0.8916
66 V A -0.9211
67 D A -1.0930
68 Y A 0.0000
69 T A -0.1835
70 I A 0.0000
71 T A 0.0019
72 V A 0.0000
73 Y A 0.0655
74 A A 0.0000
75 W A -0.5123
76 A A 0.0000
77 Y A 0.8717
78 Y A 0.4458
79 E A -1.7763
80 R A -2.0798
81 L A 0.0000
82 S A -0.6973
83 P A -0.2816
84 I A 0.0120
85 S A 0.0103
86 I A 0.0137
87 Y A 0.3794
88 R A -1.1083
89 T A -0.6244
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018