Project name: 694f527b860b4e7

Status: done

Started: 2026-07-01 15:22:05
Settings
Chain sequence(s) B: MSFTLSEELLPDGTGVLTLSGLTSELEPNTTLVWTSGGEVVQTSQVVVTP
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:10)
Show buried residues

Minimal score value
-2.3228
Maximal score value
2.2004
Average score
-0.1034
Total score value
-5.1724

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B 1.1566
2 S B 1.0498
3 F B 2.2004
4 T B 1.4783
5 L B 1.6202
6 S B -0.2219
7 E B -1.6250
8 E B -1.7087
9 L B 0.0428
10 L B -0.3743
11 P B -0.9737
12 D B -1.8321
13 G B -1.1506
14 T B -0.5534
15 G B -0.5944
16 V B -0.0109
17 L B 0.4002
18 T B 0.1835
19 L B 1.2068
20 S B 0.8385
21 G B 0.8634
22 L B 0.6852
23 T B -0.0505
24 S B -1.2756
25 E B -2.0657
26 L B -1.4766
27 E B -2.3228
28 P B -1.3768
29 N B -1.3075
30 T B -0.8770
31 T B -0.4436
32 L B 0.0887
33 V B 1.1934
34 W B 1.0706
35 T B 0.3312
36 S B -0.5137
37 G B -0.9298
38 G B -1.0244
39 E B -0.9785
40 V B 1.3669
41 V B 1.5786
42 Q B 0.2895
43 T B 0.2862
44 S B -0.4436
45 Q B -0.7555
46 V B 0.1754
47 V B 1.0438
48 V B 0.2807
49 T B 0.3196
50 P B -0.0361
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018