Project name: query_structure

Chain sequence(s)	A: EVVREVCSEQAETGPCRAAIFRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAI
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:35)

• Minimal score value: -2.9835
• Maximal score value: 2.5267
• Average score: -0.6147
• Total score value: -37.4994

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.7120
2	V	A	0.0418
3	V	A	-0.5519
4	R	A	-2.2482
5	E	A	-2.8812
6	V	A	-2.0681
7	C	A	0.0000
8	S	A	-1.6159
9	E	A	-2.9835
10	Q	A	-2.2988
11	A	A	-1.5550
12	E	A	-1.6790
13	T	A	-0.4184
14	G	A	-0.6608
15	P	A	-0.7058
16	C	A	-0.6208
17	R	A	-1.3377
18	A	A	0.0283
19	A	A	1.1223
20	I	A	1.9521
21	F	A	2.4835
22	R	A	0.4843
23	W	A	-0.3883
24	Y	A	-0.9955
25	F	A	0.0000
26	D	A	-1.3441
27	V	A	-0.2109
28	T	A	-0.8757
29	E	A	-2.1891
30	G	A	-1.1359
31	K	A	-2.2645
32	C	A	-1.4008
33	A	A	-0.8476
34	P	A	0.0454
35	F	A	1.5033
36	F	A	2.5267
37	Y	A	1.2386
38	G	A	0.0000
39	G	A	0.3179
40	C	A	0.0333
41	G	A	-0.8008
42	G	A	-1.5955
43	N	A	-2.1337
44	R	A	-2.7734
45	N	A	0.0000
46	N	A	-1.2218
47	F	A	0.0000
48	D	A	-1.8243
49	T	A	-1.5888
50	E	A	-2.3617
51	E	A	-2.0049
52	Y	A	-0.3986
53	C	A	0.0000
54	M	A	-0.5081
55	A	A	0.0443
56	V	A	0.3202
57	C	A	0.0000
58	G	A	0.2220
59	S	A	0.3484
60	A	A	0.2183
61	I	A	1.7710