Project name: query_structure

Status: done

Started: 2026-03-16 23:12:31
Settings
Chain sequence(s) A: EVQLQASGGGLVQPGGSLRLACQYSWFRQSPGKEREFVARFTTSSDNFKKTAYLQMNGLKPEDTALYYCTESQGTQVTVSSGREGTTTVGAIRWTDSRTPHTDSDTWNSVVTGTAADW
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:52)
Show buried residues

Minimal score value
-4.1578
Maximal score value
2.8578
Average score
-0.8895
Total score value
-104.9585

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.1251
2 V A 0.6458
3 Q A -0.3865
4 L A 0.6858
5 Q A -0.6520
6 A A -0.8306
7 S A -0.8482
8 G A -0.9502
9 G A -0.4488
10 G A 0.0672
11 L A 0.6736
12 V A -0.6683
13 Q A -1.5739
14 P A -1.9195
15 G A -1.6050
16 G A -1.2360
17 S A -1.5552
18 L A -1.3741
19 R A -1.9835
20 L A 0.0000
21 A A -0.0125
22 C A 0.0000
23 Q A -0.4791
24 Y A 0.3538
25 S A 0.0000
26 W A 0.0000
27 F A -0.4887
28 R A -1.5988
29 Q A -2.4884
30 S A -2.4328
31 P A -1.7616
32 G A -2.0461
33 K A -3.7374
34 E A -4.1578
35 R A -3.8057
36 E A -2.8412
37 F A -0.4197
38 V A 0.1448
39 A A 0.0636
40 R A -0.8653
41 F A 0.1128
42 T A -0.2093
43 T A -0.7094
44 S A -0.9075
45 S A -1.2789
46 D A -2.4307
47 N A -1.8299
48 F A -0.0487
49 K A -1.6555
50 K A -1.1698
51 T A -0.0489
52 A A 0.0766
53 Y A 0.6901
54 L A -0.0159
55 Q A -1.4903
56 M A -1.5517
57 N A -2.1067
58 G A -1.6112
59 L A 0.0000
60 K A -2.8265
61 P A -2.2107
62 E A -2.6781
63 D A -1.9572
64 T A -1.1996
65 A A 0.0000
66 L A -0.4143
67 Y A 0.0000
68 Y A -0.3270
69 C A 0.0000
70 T A -0.8774
71 E A -1.7915
72 S A -1.3532
73 Q A -1.8695
74 G A 0.0000
75 T A -0.6027
76 Q A -0.3714
77 V A 0.0000
78 T A -0.2756
79 V A 0.0000
80 S A -1.2161
81 S A -1.5873
82 G A -2.2542
83 R A -3.0792
84 E A -3.0671
85 G A -1.9795
86 T A -1.1980
87 T A 0.0938
88 T A 1.4284
89 V A 2.6025
90 G A 1.7734
91 A A 0.5884
92 I A 0.0808
93 R A -1.8916
94 W A -1.1907
95 T A -1.6377
96 D A -2.7798
97 S A -2.3710
98 R A -2.7169
99 T A -1.9844
100 P A -1.6320
101 H A -1.8648
102 T A -1.7865
103 D A -2.7770
104 S A -1.8999
105 D A -2.3788
106 T A -1.1639
107 W A 0.3085
108 N A -0.3676
109 S A 0.9901
110 V A 2.8025
111 V A 2.8578
112 T A 1.7019
113 G A 1.1489
114 T A 0.0674
115 A A -0.4439
116 A A -0.6421
117 D A -1.2218
118 W A 0.3259
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018