Project name: query_structure

Status: done

Started: 2026-03-16 20:38:50
Settings
Chain sequence(s) A: LQVDIVPSQGEISVGESKFFLCQVAGMLPTCEISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVHGPCQPRLTWSLGLPEATVNVKIFQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:43)
Show buried residues

Minimal score value
-3.1757
Maximal score value
1.9841
Average score
-0.5674
Total score value
-59.0082

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 0.3056
2 Q A -1.3485
3 V A -1.3749
4 D A -1.4647
5 I A 0.0000
6 V A 0.6893
7 P A -0.0254
8 S A -0.7122
9 Q A -1.7013
10 G A 0.0000
11 E A -2.4125
12 I A 0.0000
13 S A -1.0048
14 V A -0.6670
15 G A -1.4215
16 E A -2.2944
17 S A -1.0689
18 K A -0.3301
19 F A 1.9558
20 F A 0.0000
21 L A 0.7717
22 C A 0.0000
23 Q A -1.4929
24 V A 0.0000
25 A A -0.3111
26 G A 0.1835
27 M A 0.8396
28 L A 0.3592
29 P A -0.7164
30 T A -0.6032
31 C A 0.0000
32 E A -1.7912
33 I A 0.0000
34 S A 0.0000
35 W A 0.0000
36 F A -1.2774
37 S A -1.3431
38 P A -1.2034
39 N A -2.0646
40 G A -2.1921
41 E A -3.1757
42 K A -2.6734
43 L A 0.0000
44 T A -1.1680
45 P A -0.8721
46 N A -2.1201
47 Q A -2.2954
48 Q A -2.3136
49 R A -1.8503
50 I A 0.0000
51 S A -0.3192
52 V A 0.0000
53 V A 0.7545
54 W A -0.4859
55 N A -1.8560
56 D A -3.0177
57 D A -2.8587
58 S A -1.7307
59 S A -1.6312
60 S A 0.0000
61 T A 0.6950
62 L A 0.0000
63 T A 0.8722
64 I A 0.0000
65 Y A -0.7563
66 N A -2.1151
67 A A 0.0000
68 N A -1.1795
69 I A 0.1370
70 D A -1.3082
71 D A 0.0000
72 A A -0.5867
73 G A -0.1260
74 I A 0.5460
75 Y A 0.0000
76 K A -1.0211
77 C A 0.0000
78 V A 0.0000
79 V A 0.0000
80 H A -0.7543
81 G A -0.6275
82 P A -0.7700
83 C A -0.2855
84 Q A 0.0000
85 P A -0.2487
86 R A -0.9314
87 L A 1.1614
88 T A 1.2285
89 W A 1.4113
90 S A 1.1366
91 L A 1.9841
92 G A 0.7935
93 L A 0.3407
94 P A -0.5393
95 E A -1.8988
96 A A -1.3418
97 T A -0.5892
98 V A 0.0000
99 N A -0.9615
100 V A 0.0000
101 K A -1.1866
102 I A -0.6427
103 F A 0.1979
104 Q A -0.3118
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018