Project name: 5.P2H7.pdb

Chain sequence(s)	H: QVQLVESGGGLVQAGGSLRLSCVASGLTFIEYGMGWFRQAPGKEREFVSAISWSGGSTYYADSVKGRFTISREHAKNTVYLQMNSLKPEDTAVYYCAASRRAGWSNIPAHDYDYWGQGTQVTVSS
Selected Chain(s)	H
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:29)

• Minimal score value: -3.3025
• Maximal score value: 1.4354
• Average score: -0.5794
• Total score value: -72.4235

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	H	-1.6072
2	V	H	0.0000
3	Q	H	-1.1076
4	L	H	0.0000
5	V	H	1.3366
6	E	H	0.3811
7	S	H	-0.2172
8	G	H	-0.9985
9	G	H	-0.6000
11	G	H	0.1035
12	L	H	1.1665
13	V	H	0.1169
14	Q	H	-1.1933
15	A	H	-1.5161
16	G	H	-1.2731
17	G	H	-0.8553
18	S	H	-1.0819
19	L	H	-0.6628
20	R	H	-1.7398
21	L	H	0.0000
22	S	H	-0.0991
23	C	H	0.0000
24	V	H	0.7234
25	A	H	0.0000
26	S	H	-0.8154
27	G	H	-1.2434
28	L	H	-0.7200
29	T	H	-0.0753
30	F	H	0.0000
35	I	H	1.4260
36	E	H	-0.3668
37	Y	H	0.0000
38	G	H	0.0000
39	M	H	0.0000
40	G	H	0.0000
41	W	H	0.0000
42	F	H	0.0000
43	R	H	0.0000
44	Q	H	-1.8145
45	A	H	-1.7594
46	P	H	-1.3540
47	G	H	-1.9171
48	K	H	-3.2270
49	E	H	-3.3025
50	R	H	-2.2303
51	E	H	-1.3395
52	F	H	0.0713
53	V	H	0.0000
54	S	H	0.0000
55	A	H	0.0000
56	I	H	0.0000
57	S	H	0.0000
58	W	H	0.4924
59	S	H	-0.0741
62	G	H	-0.3620
63	G	H	-0.6222
64	S	H	-0.1395
65	T	H	0.1699
66	Y	H	0.5522
67	Y	H	-0.3439
68	A	H	-0.9837
69	D	H	-2.4286
70	S	H	-1.7399
71	V	H	0.0000
72	K	H	-2.5360
74	G	H	-1.7432
75	R	H	-1.5990
76	F	H	0.0000
77	T	H	-0.7552
78	I	H	0.0000
79	S	H	-0.3839
80	R	H	0.0000
81	E	H	-1.3394
82	H	H	-1.0267
83	A	H	-1.2505
84	K	H	-2.0632
85	N	H	-1.0262
86	T	H	0.0000
87	V	H	0.0000
88	Y	H	-0.3585
89	L	H	0.0000
90	Q	H	-1.0869
91	M	H	0.0000
92	N	H	-1.3125
93	S	H	-1.1712
94	L	H	0.0000
95	K	H	-2.0850
96	P	H	-1.7199
97	E	H	-2.2135
98	D	H	0.0000
99	T	H	-0.7413
100	A	H	0.0000
101	V	H	-0.2633
102	Y	H	0.0000
103	Y	H	-0.0913
104	C	H	0.0000
105	A	H	0.0000
106	A	H	0.0000
107	S	H	0.0000
108	R	H	-2.9556
109	R	H	-2.9066
110	A	H	-1.1215
111	G	H	0.0000
111A	W	H	1.0770
111B	S	H	0.7897
112C	N	H	0.0000
112B	I	H	1.4354
112A	P	H	0.1527
112	A	H	-0.5627
113	H	H	-1.2467
114	D	H	-1.4991
115	Y	H	0.0000
116	D	H	-2.3138
117	Y	H	-0.9824
118	W	H	-0.1934
119	G	H	0.0000
120	Q	H	-0.8914
121	G	H	-0.4700
122	T	H	-0.4959
123	Q	H	-0.5728
124	V	H	0.0000
125	T	H	-0.1296
126	V	H	0.0000
127	S	H	-0.7184
128	S	H	-0.7805