Project name: query_structure

Status: done

Started: 2026-03-16 23:06:31
Settings
Chain sequence(s) A: ECRKMFGGCSVDSDCCAHLGCKPTLKYCAWDGTF
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:30)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:31)
Show buried residues

Minimal score value
-1.9085
Maximal score value
1.5279
Average score
-0.6294
Total score value
-21.3995

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.9085
2 C A -1.2617
3 R A -1.6433
4 K A -1.2981
5 M A 0.5658
6 F A 1.5279
7 G A -0.0938
8 G A -0.2227
9 C A -0.7697
10 S A -0.3718
11 V A 0.1271
12 D A -1.6052
13 S A -0.8946
14 D A -1.1517
15 C A -1.2790
16 C A -0.9380
17 A A -0.8159
18 H A -1.5021
19 L A -1.4346
20 G A -1.5995
21 C A 0.0000
22 K A -0.8815
23 P A -0.5944
24 T A -0.1073
25 L A 0.1608
26 K A -1.0176
27 Y A -0.2503
28 C A 0.0000
29 A A -0.4793
30 W A -0.4407
31 D A -1.4739
32 G A -1.0958
33 T A 0.0338
34 F A 1.3161
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018