Project name: semaglutide_agg2

Status: done

Started: 2026-06-23 12:35:30
Settings
Chain sequence(s) A: HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:28)
Show buried residues

Minimal score value
-2.0894
Maximal score value
2.2585
Average score
0.2347
Total score value
7.0405

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 H A -1.6640
2 A A -1.2263
3 E A -2.0894
4 G A -1.1497
5 T A -0.2186
6 F A 1.0254
7 T A 0.2687
8 S A 0.1626
9 D A -0.3216
10 V A 1.7741
11 S A 1.2805
12 S A 1.0718
13 Y A 1.9893
14 L A 1.9655
15 E A 0.0000
16 G A -0.2787
17 Q A -0.4588
18 A A -0.3687
19 A A 0.0000
20 K A -1.3015
21 E A 0.1672
22 F A 1.6722
23 I A 1.9893
24 A A 0.0000
25 W A 1.4678
26 L A 2.2585
27 V A 1.9980
28 R A -0.6884
29 G A -0.7034
30 R A -1.5813
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018