Project name: 6aacc8bf15c3484

Chain sequence(s)	A: MADVQLVESGGGLVQAGGSLRLSCAASGGTISNYGMGWLRQGPGKEREFVGSINWNGATTHYADSVKGRFIISRDNAKNTVYLQMNSLKPEDTGVYYCVAQFSVQPTLQTYDYRGQGTQVTVSEPKTPGGSHHHHHHLEVSGWRLFKKIS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:09)

• Minimal score value: -4.228
• Maximal score value: 1.6112
• Average score: -0.8748
• Total score value: -131.2157

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.4925
2	A	A	-0.6887
3	D	A	-1.9348
4	V	A	0.0000
5	Q	A	-1.7899
6	L	A	0.0000
7	V	A	0.8958
8	E	A	0.0000
9	S	A	-0.5863
10	G	A	-1.2442
11	G	A	-0.8486
12	G	A	-0.0995
13	L	A	1.0480
14	V	A	-0.1955
15	Q	A	-1.9003
16	A	A	-2.1626
17	G	A	-1.5320
18	G	A	-0.8088
19	S	A	-1.1897
20	L	A	-1.0665
21	R	A	-2.1631
22	L	A	0.0000
23	S	A	-0.4861
24	C	A	0.0000
25	A	A	-0.1314
26	A	A	0.0000
27	S	A	-1.1100
28	G	A	-1.2883
29	G	A	-1.0303
30	T	A	-0.5920
31	I	A	-0.8531
32	S	A	-1.1819
33	N	A	-1.0129
34	Y	A	0.0000
35	G	A	0.0000
36	M	A	0.0000
37	G	A	0.0000
38	W	A	0.0000
39	L	A	0.0000
40	R	A	-1.8816
41	Q	A	-2.8086
42	G	A	-2.3620
43	P	A	-1.5220
44	G	A	-2.1234
45	K	A	-3.7380
46	E	A	-4.2280
47	R	A	-4.0772
48	E	A	-3.3110
49	F	A	-1.5389
50	V	A	0.0000
51	G	A	0.0000
52	S	A	0.0000
53	I	A	0.0000
54	N	A	-0.3847
55	W	A	-0.5576
56	N	A	-1.7941
57	G	A	-1.1320
58	A	A	-0.4888
59	T	A	-0.3997
60	T	A	-0.1373
61	H	A	-0.6148
62	Y	A	-0.9120
63	A	A	-1.5839
64	D	A	-2.5599
65	S	A	-1.9272
66	V	A	0.0000
67	K	A	-2.5641
68	G	A	-1.6037
69	R	A	-1.3142
70	F	A	0.0000
71	I	A	-0.0337
72	I	A	0.0000
73	S	A	-0.4494
74	R	A	-1.4514
75	D	A	-2.2225
76	N	A	-2.4020
77	A	A	-1.6464
78	K	A	-2.4637
79	N	A	-1.9191
80	T	A	-1.1394
81	V	A	0.0000
82	Y	A	0.0000
83	L	A	0.0000
84	Q	A	-1.2127
85	M	A	0.0000
86	N	A	-1.1292
87	S	A	-1.0897
88	L	A	0.0000
89	K	A	-2.3441
90	P	A	-2.0937
91	E	A	-2.1418
92	D	A	0.0000
93	T	A	-0.8091
94	G	A	0.0000
95	V	A	-0.6048
96	Y	A	0.0000
97	Y	A	-0.8655
98	C	A	0.0000
99	V	A	0.0000
100	A	A	0.0000
101	Q	A	0.0000
102	F	A	1.3336
103	S	A	1.1545
104	V	A	1.6112
105	Q	A	0.2035
106	P	A	0.1192
107	T	A	0.0196
108	L	A	0.3637
109	Q	A	-1.2880
110	T	A	-0.8480
111	Y	A	-0.9424
112	D	A	-1.7797
113	Y	A	-1.6667
114	R	A	-2.2813
115	G	A	-1.1482
116	Q	A	-1.4197
117	G	A	0.0000
118	T	A	-0.6818
119	Q	A	-1.1488
120	V	A	0.0000
121	T	A	-0.4097
122	V	A	0.0000
123	S	A	-1.8203
124	E	A	-3.1812
125	P	A	-2.5404
126	K	A	-2.6426
127	T	A	-1.5667
128	P	A	-1.1500
129	G	A	-1.2099
130	G	A	-1.1924
131	S	A	-1.4769
132	H	A	-2.1707
133	H	A	-2.5214
134	H	A	-2.6881
135	H	A	-2.4904
136	H	A	-2.2113
137	H	A	-1.4744
138	L	A	0.1905
139	E	A	-0.6729
140	V	A	1.0922
141	S	A	0.1385
142	G	A	-0.1164
143	W	A	0.9498
144	R	A	-0.2759
145	L	A	1.1841
146	F	A	1.3471
147	K	A	-0.9687
148	K	A	-0.9856
149	I	A	0.8752
150	S	A	0.2152