Project name: 41504f35d638ad5e3fb1e445f18dd762

Status: done

Started: 2026-03-07 01:29:18
Settings
Chain sequence(s) B: MEEELKEAKELAKKFGEWLKKNPELVNKVSVKVEGLSEEEQKVFQEEYEKYKKEVLKKLKGSGC
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:08)
Show buried residues

Minimal score value
-4.1437
Maximal score value
0.0
Average score
-2.1704
Total score value
-138.9062

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B -0.9858
2 E B -3.2117
3 E B -4.1437
4 E B -4.1261
5 L B -3.4274
6 K B -3.8285
7 E B -4.0262
8 A B 0.0000
9 K B -3.1199
10 E B -2.7548
11 L B -1.7516
12 A B 0.0000
13 K B -2.5195
14 K B -2.3672
15 F B -0.9227
16 G B 0.0000
17 E B -2.5522
18 W B -1.4090
19 L B 0.0000
20 K B -3.0582
21 K B -2.6941
22 N B -2.0143
23 P B -2.5241
24 E B -2.4914
25 L B -1.6755
26 V B 0.0000
27 N B -2.0390
28 K B -2.2015
29 V B -0.9939
30 S B -0.7972
31 V B -0.6961
32 K B -2.0699
33 V B -1.5947
34 E B -2.2956
35 G B -1.6287
36 L B -2.1288
37 S B -2.3083
38 E B -3.3058
39 E B -3.5938
40 E B -3.2755
41 Q B -3.2953
42 K B -3.5581
43 V B -3.0247
44 F B 0.0000
45 Q B -3.2332
46 E B -3.5885
47 E B -2.9554
48 Y B 0.0000
49 E B -3.5735
50 K B -3.6900
51 Y B -3.0254
52 K B -2.6638
53 K B -3.0380
54 E B -3.1593
55 V B 0.0000
56 L B 0.0000
57 K B -3.2907
58 K B -3.2955
59 L B -2.4840
60 K B -2.5820
61 G B -1.6805
62 S B -1.4182
63 G B -0.6730
64 C B -0.1444
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018