Project name: query_structure

Status: done

Started: 2026-03-17 01:20:42
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYFITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAWSDYYPLYWEGSSSPISIYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:34)
Show buried residues

Minimal score value
-2.5459
Maximal score value
2.7089
Average score
-0.2014
Total score value
-19.1293

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7979
2 S A 0.8223
3 S A 0.7148
4 V A 0.3598
5 P A 0.0000
6 T A -1.5013
7 K A -2.5459
8 L A 0.0000
9 E A -1.6889
10 V A 0.3478
11 V A 1.5545
12 A A 0.8995
13 A A 0.2643
14 T A -0.4016
15 P A -1.1220
16 T A -1.0145
17 S A -0.5581
18 L A 0.0000
19 L A 0.7371
20 I A 0.0000
21 S A -0.8918
22 W A 0.0000
23 D A -2.4406
24 A A -1.1229
25 P A 0.0000
26 A A 0.4597
27 V A 0.8736
28 T A 0.1844
29 V A 0.1505
30 D A -0.3146
31 F A 0.4410
32 Y A 0.0000
33 F A 0.4588
34 I A 0.0000
35 T A -0.3821
36 Y A 0.0000
37 G A 0.0000
38 E A -1.1842
39 T A -0.7643
40 G A -1.1005
41 G A -1.2315
42 N A -1.4909
43 S A -0.7693
44 P A -0.2682
45 V A 0.5000
46 Q A -0.7633
47 E A -1.4833
48 F A -0.5047
49 T A 0.2198
50 V A 0.0000
51 P A -0.4139
52 G A -0.4096
53 S A -1.0401
54 K A -1.9776
55 S A -1.2974
56 T A -0.7445
57 A A 0.0000
58 T A 0.2304
59 I A 0.0000
60 S A -0.6691
61 G A -1.0492
62 L A 0.0000
63 K A -2.1015
64 P A -1.5797
65 G A -1.3788
66 V A -1.1394
67 D A -1.2255
68 Y A 0.0000
69 T A -0.0204
70 I A 0.0000
71 T A 0.0464
72 V A 0.0000
73 Y A 0.5403
74 A A 0.0000
75 W A 0.5867
76 S A 0.1829
77 D A -0.7359
78 Y A 1.2881
79 Y A 2.2686
80 P A 1.3919
81 L A 2.7089
82 Y A 2.2479
83 W A 1.3542
84 E A -0.7152
85 G A -0.1632
86 S A -0.1607
87 S A -0.0950
88 S A -0.1057
89 P A -0.0082
90 I A -0.1429
91 S A 0.1728
92 I A 0.0000
93 Y A 0.4232
94 R A -1.4825
95 T A -1.1569
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018