Project name: 1igt_WT [mutate: VT177B, LE178B] [mutate: VT177B, LE178B] [mutate: VT177B, LQ178B]

Status: error

Started: 2025-07-23 22:17:51
Settings
Chain sequence(s) B: EVKLQESGGGLVQPGGSLKLSCATSGFTFSDYYMYWVRQTPEKRLEWVAYISNGGGSTYYPDTVKGRFTISRDNAKNTLYLQMSRLKSEDTAMYYCARHGGYYAMDYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSR
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode Yes
Automated mutations No
Mutated residues LQ178B,VT177B
Energy difference between WT (input) and mutated protein (by FoldX) 0.0 kcal/mol
Error log
One of Aggrescan3D modules (CABS) encountered an error. 
Traceback (most recent call last):
  File "/home/users/lcbio/mambaforge/lib/python3.10/runpy.py", line 189, in _run_module_as_main
    mod_name, mod_spec, code = _get_main_module_details(_Error)
  File "/home/users/lcbio/mambaforge/lib/python3.10/runpy.py", line 238, in _get_main_module_details
    return _get_module_details(main_name)
  File "/home/users/lcbio/mambaforge/lib/python3.10/runpy.py", line 157, in _get_module_details
    code = loader.get_code(mod_name)
  File "<frozen importlib._bootstrap_external>", line 1017, in get_code
  File "<frozen importlib._bootstrap_external>", line 947, in source_to_code
  File "<frozen importlib._bootstrap>", line 241, in _call_with_frames_removed
  File "/home/users/lcbio/anaconda2/envs/exec/lib/python2.7/site-packages/CABS/__main__.py", line 31
    print __version__
    ^^^^^^^^^^^^^^^^^
SyntaxError: Missing parentheses in call to 'print'. Did you mean print(...)?
One of Aggrescan3D modules (FoldX) encountered an error. 
FoldX didn't produce expected repair files. Can't continue without it. This is unexpected and could indicate FoldX issues.One of Aggrescan3D modules (FoldX) encountered an error. 
FoldX didn't produce expected repair files. Can't continue without it. This is unexpected and could indicate FoldX issues.

Laboratory of Theory of Biopolymers 2018