Project name: 6bc5ab64eedcdea

Status: done

Started: 2026-06-22 16:03:13
Settings
Chain sequence(s) B: SFADELKASLEKVKALAEKMKAEGNEELAKALEQMAKKLAEILEKVEKTL
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:14)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:14)
Show buried residues

Minimal score value
-4.4786
Maximal score value
0.3553
Average score
-2.4115
Total score value
-120.5763

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B -0.4663
2 F B 0.3553
3 A B -1.2316
4 D B -2.6317
5 E B -2.5253
6 L B 0.0000
7 K B -2.6253
8 A B -2.4428
9 S B -2.3996
10 L B 0.0000
11 E B -3.3632
12 K B -3.1142
13 V B 0.0000
14 K B -3.3333
15 A B -2.7012
16 L B -1.9811
17 A B 0.0000
18 E B -4.1977
19 K B -3.3841
20 M B -3.4933
21 K B -4.4786
22 A B -3.0363
23 E B -3.4855
24 G B -3.1615
25 N B -3.6379
26 E B -4.3197
27 E B -3.4119
28 L B -2.5779
29 A B 0.0000
30 K B -3.7279
31 A B -2.0469
32 L B -2.5219
33 E B -3.7164
34 Q B -2.9202
35 M B -1.9493
36 A B 0.0000
37 K B -3.4351
38 K B -3.1905
39 L B -2.2165
40 A B -2.6000
41 E B -3.3669
42 I B -1.9928
43 L B -2.7314
44 E B -3.8524
45 K B -3.3964
46 V B -1.7954
47 E B -3.1671
48 K B -2.9928
49 T B -1.3645
50 L B 0.0528
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018