Project name: GapC162_tagged_rank1_A3D_static_d10

Status: done

Started: 2026-07-24 04:35:00
Settings
Chain sequence(s) A: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMVVKVGINGFGRIGRLAFRRIQNVEGVEVTRINDLTDPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVNGQFVKVSAEREPANIDWATDGVEIVLEATGFFASKEKAEQHIHENGAKKVVILEHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)
Show buried residues

Minimal score value
-3.5575
Maximal score value
1.8694
Average score
-0.8976
Total score value
-145.4181

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.7722
2 G A -0.0913
3 S A -0.5531
4 S A -1.1366
5 H A -1.8473
6 H A -2.2584
7 H A -2.3975
8 H A -2.4147
9 H A -2.2328
10 H A -1.9037
11 S A -1.1545
12 S A -0.4647
13 G A 0.4030
14 L A 1.8694
15 V A 1.7820
16 P A -0.0376
17 R A -1.6285
18 G A -1.5688
19 S A -1.1687
20 H A -0.6514
21 M A 0.4929
22 A A 0.5364
23 S A 0.4893
24 M A 0.7459
25 T A -0.1540
26 G A -1.0926
27 G A -1.3857
28 Q A -1.9021
29 Q A -1.9756
30 M A -0.8568
31 G A -1.5346
32 R A -2.0381
33 G A -0.9879
34 S A -0.5598
35 M A 0.8713
36 V A 1.0613
37 V A 0.6780
38 K A -0.1658
39 V A 0.0000
40 G A 0.0000
41 I A 0.0000
42 N A 0.0000
43 G A 0.0000
44 F A 0.0000
45 G A -0.4549
46 R A -0.5456
47 I A -0.1468
48 G A 0.0000
49 R A -0.3798
50 L A -0.1559
51 A A -0.3293
52 F A 0.0000
53 R A -1.4356
54 R A -2.0041
55 I A -1.2804
56 Q A -1.9240
57 N A -1.9815
58 V A -1.1260
59 E A -1.5920
60 G A -0.2248
61 V A 0.1365
62 E A -0.4898
63 V A 0.0000
64 T A -0.2860
65 R A 0.0000
66 I A 0.0000
67 N A 0.0000
68 D A -0.2949
69 L A 0.3697
70 T A -0.2515
71 D A -1.4896
72 P A -1.6787
73 N A -1.9017
74 M A -0.5447
75 L A 0.0000
76 A A 0.0000
77 H A -0.5667
78 L A -0.0339
79 L A 0.0000
80 K A -1.1484
81 Y A 0.0163
82 D A 0.0000
83 T A -0.4390
84 T A -0.7946
85 Q A -1.3327
86 G A -1.5999
87 R A -2.3284
88 F A 0.0000
89 D A -2.7113
90 G A -1.9221
91 T A -1.6971
92 V A 0.0000
93 E A -2.0726
94 V A -1.3064
95 K A -2.3907
96 E A -2.7360
97 G A -1.7260
98 G A 0.0000
99 F A 0.0000
100 E A -1.5650
101 V A 0.0000
102 N A -2.1155
103 G A -1.5591
104 Q A -1.3450
105 F A -0.1033
106 V A 0.0000
107 K A -1.0947
108 V A 0.0000
109 S A -0.7031
110 A A -0.6493
111 E A -1.9536
112 R A -2.8115
113 E A -3.0010
114 P A 0.0000
115 A A -2.1638
116 N A -2.6095
117 I A 0.0000
118 D A -1.8313
119 W A 0.0000
120 A A -1.5132
121 T A -0.6798
122 D A -0.8103
123 G A -0.7117
124 V A 0.0000
125 E A -1.3912
126 I A -0.6388
127 V A 0.0000
128 L A 0.6498
129 E A 0.0000
130 A A 0.0408
131 T A 0.2795
132 G A 0.1703
133 F A 1.6653
134 F A -0.2050
135 A A -0.5735
136 S A -1.6362
137 K A -3.0748
138 E A -3.5575
139 K A -2.4868
140 A A 0.0000
141 E A -2.6700
142 Q A -1.9204
143 H A 0.0000
144 I A -1.0286
145 H A -1.8371
146 E A -2.6281
147 N A -2.6523
148 G A -2.2016
149 A A 0.0000
150 K A -2.8122
151 K A -2.1378
152 V A -0.6382
153 V A 0.3851
154 I A 0.0836
155 L A -0.3868
156 E A -2.3614
157 H A -2.6280
158 H A -2.8526
159 H A -2.9247
160 H A -2.6759
161 H A -2.3880
162 H A -1.9025
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018