Project name: query_structure

Status: done

Started: 2026-03-16 23:36:13
Settings
Chain sequence(s) A: GSSVSSVPTKLEVVAATPTSLLISWDASSSSVSHYAITYGETGGNSPVQEFTVPGSSSTATISGLSPGVDYTITVYAYHSYDDIFLADSPSSINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:22)
Show buried residues

Minimal score value
-2.5581
Maximal score value
2.8267
Average score
-0.3299
Total score value
-32.0011

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.4242
2 S A -0.0969
3 S A 0.3711
4 V A 1.2526
5 S A 0.3419
6 S A -0.1389
7 V A -0.4460
8 P A 0.0000
9 T A -1.5634
10 K A -2.4950
11 L A 0.0000
12 E A -1.6832
13 V A 0.2289
14 V A 1.6043
15 A A 0.9257
16 A A 0.3050
17 T A -0.3840
18 P A -0.8088
19 T A -0.5242
20 S A -0.3171
21 L A 0.0000
22 L A 0.7717
23 I A 0.0000
24 S A -0.7013
25 W A 0.0000
26 D A -2.5581
27 A A -1.2538
28 S A -0.9598
29 S A -0.5663
30 S A -0.3880
31 S A -0.1879
32 V A 0.1380
33 S A 0.2003
34 H A -0.2694
35 Y A 0.0000
36 A A 0.0000
37 I A 0.0000
38 T A -0.5199
39 Y A -0.3974
40 G A 0.0000
41 E A -1.2900
42 T A -1.1671
43 G A -1.2079
44 G A -1.3189
45 N A -1.5319
46 S A -0.9021
47 P A -0.4180
48 V A 0.2631
49 Q A -1.1936
50 E A -1.7287
51 F A -0.6247
52 T A -0.1657
53 V A -0.0390
54 P A -0.3770
55 G A -0.3970
56 S A -0.4145
57 S A -0.4773
58 S A -0.6958
59 T A -0.2369
60 A A 0.0000
61 T A 0.2518
62 I A 0.0000
63 S A -0.4733
64 G A -0.6847
65 L A 0.0000
66 S A -0.8177
67 P A -0.9779
68 G A -1.0529
69 V A -0.8652
70 D A -1.7299
71 Y A 0.0000
72 T A -0.6948
73 I A 0.0000
74 T A -0.1368
75 V A 0.0000
76 Y A 0.1184
77 A A 0.0000
78 Y A 1.1695
79 H A 0.0000
80 S A 0.8634
81 Y A 0.5774
82 D A -1.4464
83 D A -0.9323
84 I A 1.9926
85 F A 2.8267
86 L A 2.2858
87 A A 0.9671
88 D A -0.2419
89 S A -0.3904
90 P A -0.2568
91 S A 0.0000
92 S A -0.6464
93 I A -0.7714
94 N A -1.6549
95 Y A -1.3652
96 R A -2.2853
97 T A -1.1625
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018