Project name: 6cea2e3bd3b0e43

Status: done

Started: 2024-12-30 07:26:54
Settings
Chain sequence(s) A: MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:07)
Show buried residues

Minimal score value
-4.106
Maximal score value
2.1411
Average score
-0.7309
Total score value
-126.4482

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.9764
2 D A -0.2639
3 V A 1.4674
4 T A 0.9354
5 I A 1.5344
6 Q A -0.3277
7 H A -0.1271
8 P A -0.0789
9 W A 0.0530
10 F A -0.5807
11 K A -1.2317
12 R A -1.6992
13 T A -0.2525
14 L A 0.2960
15 G A -0.0224
16 P A 0.4700
17 F A 1.9553
18 Y A 1.0039
19 P A 0.0192
20 S A -0.6002
21 R A -1.9669
22 L A -0.0991
23 F A 0.4351
24 D A -0.6698
25 Q A 0.0000
26 F A 0.0000
27 F A 0.6680
28 G A -0.2645
29 E A -1.4166
30 G A -0.6233
31 L A 1.3418
32 F A 1.4825
33 E A -0.5265
34 Y A 0.7136
35 D A -0.1169
36 L A 1.3263
37 L A 1.3004
38 P A 1.1400
39 F A 2.1411
40 L A 0.7727
41 S A 0.6109
42 S A 0.8996
43 T A 1.1055
44 I A 1.8787
45 S A 1.1818
46 P A 0.8194
47 Y A 0.4290
48 Y A 0.3305
49 R A -0.2251
50 Q A 0.0000
51 S A 0.0000
52 L A 0.7587
53 F A 1.1183
54 R A 0.2138
55 T A 0.3333
56 V A 1.4115
57 L A 0.3010
58 D A -1.1184
59 S A -0.7432
60 G A -0.3116
61 I A 1.1678
62 S A -0.3798
63 E A -1.6286
64 V A 0.0000
65 R A -1.8177
66 S A -2.1269
67 D A -3.0481
68 R A -3.1964
69 D A -1.9011
70 K A -1.6879
71 F A 0.0000
72 V A 0.0000
73 I A 0.0000
74 F A -0.4126
75 L A 0.0000
76 D A -2.2577
77 V A 0.0000
78 K A -2.5203
79 H A -2.8026
80 F A 0.0000
81 S A 0.0000
82 P A 0.0000
83 E A -2.0372
84 D A 0.0000
85 L A 0.0000
86 T A -0.8595
87 V A 0.0000
88 K A -1.8778
89 V A 0.0000
90 Q A -3.0781
91 D A -3.5457
92 D A -3.5438
93 F A -2.3911
94 V A 0.0000
95 E A -2.6787
96 I A 0.0000
97 H A -2.2035
98 G A 0.0000
99 K A -3.4965
100 H A 0.0000
101 N A -2.8815
102 E A -2.9669
103 R A -3.2032
104 Q A -3.5707
105 D A -3.9403
106 D A -3.5030
107 H A -2.1964
108 G A -0.6545
109 Y A 0.5094
110 I A 1.3808
111 S A -1.0989
112 R A -2.7325
113 E A -3.2717
114 F A -2.2694
115 H A -2.6155
116 R A -2.5004
117 R A -3.4542
118 Y A -1.9624
119 R A -2.3215
120 L A -0.9613
121 P A -0.5717
122 S A -0.7382
123 N A 0.0000
124 V A 0.0000
125 D A -0.8538
126 Q A 0.0000
127 S A -0.5993
128 A A -0.3287
129 L A -0.3228
130 S A -0.3369
131 C A 0.0000
132 S A -0.8235
133 L A -0.2949
134 S A 0.0911
135 A A -0.2339
136 D A -1.5637
137 G A -1.2645
138 M A 0.0000
139 L A 0.0000
140 T A 0.0183
141 F A 0.0000
142 C A 0.0000
143 G A 0.0000
144 P A -0.8140
145 K A -1.2050
146 I A 0.4120
147 Q A -0.7780
148 T A -0.4816
149 G A -0.2863
150 L A 0.2657
151 D A -1.4239
152 A A -0.6174
153 T A -0.6713
154 H A -2.0836
155 A A -2.0738
156 E A -3.1161
157 R A -2.3434
158 A A -1.1895
159 I A -0.4576
160 P A -0.5837
161 V A -0.6405
162 S A -1.6435
163 R A -3.2131
164 E A -3.8535
165 E A -4.1060
166 K A -3.4517
167 P A -1.7682
168 T A -1.1062
169 S A -1.6440
170 A A -0.8608
171 P A -1.1124
172 S A -1.7198
173 S A -1.6789
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018