Project name: FIX-1

Status: done

Started: 2026-06-20 02:30:24
Settings
Chain sequence(s) A: YVDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTR
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:01)
Show buried residues

Minimal score value
-3.9784
Maximal score value
2.3472
Average score
-0.9458
Total score value
-128.6322

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Y A 1.9158
2 V A 1.5733
3 D A -0.3980
4 G A -1.7656
5 D A -3.6631
6 Q A -3.5210
7 C A -3.3095
8 E A -3.2981
9 S A -2.0979
10 N A -2.2162
11 P A -1.1739
12 C A -0.6310
13 L A 0.0901
14 N A -0.7117
15 G A -0.4063
16 G A -0.2105
17 S A -0.5450
18 C A -1.5883
19 K A -2.8137
20 D A -3.9784
21 D A -2.9718
22 I A -0.3473
23 N A -1.5254
24 S A -1.9651
25 Y A -2.3649
26 E A -2.6403
27 C A -1.2243
28 W A 0.5451
29 C A 0.3439
30 P A 0.8926
31 F A 1.8937
32 G A 0.0000
33 F A -0.0281
34 E A -1.4313
35 G A -1.4999
36 K A -2.1832
37 N A -1.4031
38 C A 0.0000
39 E A -0.8944
40 L A -0.1636
41 D A -0.9914
42 V A -0.6519
43 T A -1.3667
44 C A -1.7335
45 N A -2.0083
46 I A -1.1750
47 K A -2.8022
48 N A -2.4520
49 G A 0.0000
50 R A -3.0619
51 C A 0.0000
52 E A -2.6657
53 Q A -0.7535
54 F A 0.3174
55 C A -1.1551
56 K A -2.0678
57 N A -2.8805
58 S A -2.2978
59 A A -2.0168
60 D A -3.1268
61 N A -3.4559
62 K A -3.1693
63 V A -1.9015
64 V A -0.4571
65 C A 0.0000
66 S A -0.3720
67 C A -0.7533
68 T A -0.8680
69 E A -1.9613
70 G A -0.9409
71 Y A -0.7058
72 R A -1.8498
73 L A -1.9501
74 A A -2.2719
75 E A -3.1600
76 N A -2.8914
77 Q A -3.0397
78 K A -2.6001
79 S A -2.3949
80 C A -1.7636
81 E A -1.3940
82 P A -0.1556
83 A A 0.1854
84 V A 1.8627
85 P A 1.3910
86 F A 2.3472
87 P A 0.8082
88 C A 0.6773
89 G A -0.3065
90 R A -0.8731
91 V A 1.2455
92 S A 0.6883
93 V A 1.5004
94 S A 0.2257
95 Q A -1.0986
96 T A -0.8142
97 S A -1.0432
98 K A -1.4425
99 L A 0.1463
100 T A -0.9425
101 R A -2.1610
102 A A -1.3292
103 E A -1.5848
104 T A 0.1860
105 V A 1.8840
106 F A 2.3093
107 P A 0.4789
108 D A -0.6625
109 V A 0.8581
110 D A -0.5064
111 Y A 1.1030
112 V A 1.2444
113 N A -0.7968
114 S A -1.1205
115 T A -1.4774
116 E A -1.8342
117 A A -0.9874
118 E A -1.9065
119 T A -0.7612
120 I A 1.1712
121 L A 0.8042
122 D A -1.3242
123 N A -0.8918
124 I A 0.9176
125 T A -0.5416
126 Q A -1.6202
127 S A -0.8186
128 T A -0.7065
129 Q A -1.4446
130 S A -0.5946
131 F A 0.5698
132 N A -1.4106
133 D A -1.7037
134 F A 0.5719
135 T A -0.5617
136 R A -1.8799
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018