Project name: query_structure

Status: done

Started: 2026-03-17 00:51:39
Settings
Chain sequence(s) A: QVQLVESGGGLVQAGGSLRLSSAASGFPVYAYVMAWYRQAPGKEREWVAAIKSQGVSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYSYVYVGTSYTGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:16)
Show buried residues

Minimal score value
-3.7204
Maximal score value
1.6294
Average score
-0.6136
Total score value
-69.9455

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.4907
2 V A -0.8749
3 Q A -0.8163
4 L A 0.0000
5 V A 1.2284
6 E A 0.0000
7 S A -0.5749
8 G A -1.0663
9 G A -0.8690
10 G A -0.1108
11 L A 0.9080
12 V A 0.0000
13 Q A -1.3015
14 A A -1.3858
15 G A -1.2909
16 G A -0.8716
17 S A -1.1022
18 L A -1.0205
19 R A -2.3071
20 L A 0.0000
21 S A -0.4897
22 S A 0.0000
23 A A -0.0675
24 A A 0.0000
25 S A -0.7075
26 G A -1.0812
27 F A 0.0000
28 P A -0.3575
29 V A 0.0000
30 Y A 0.1575
31 A A 0.2672
32 Y A 0.9573
33 V A 1.0445
34 M A 0.0000
35 A A 0.0000
36 W A 0.0000
37 Y A -0.2370
38 R A -1.3252
39 Q A -2.2455
40 A A -2.1473
41 P A -1.5026
42 G A -2.0055
43 K A -3.4423
44 E A -3.7204
45 R A -3.0557
46 E A -1.8861
47 W A -0.5354
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 I A 0.0000
52 K A -0.0501
53 S A 0.0265
54 Q A -0.6897
55 G A -0.1514
56 V A 1.1677
57 S A 0.5856
58 T A 0.6511
59 Y A 0.4452
60 Y A -0.3902
61 A A -1.1184
62 D A -2.3364
63 S A -1.8403
64 V A 0.0000
65 K A -2.5189
66 G A -1.7839
67 R A -1.5149
68 F A 0.0000
69 T A -0.8850
70 I A 0.0000
71 S A -0.9285
72 R A -1.7140
73 D A -2.0683
74 N A -2.1158
75 A A -1.5631
76 K A -2.4486
77 N A -1.7273
78 T A 0.0000
79 V A 0.0000
80 Y A 0.0000
81 L A 0.0000
82 Q A -1.6318
83 M A 0.0000
84 N A -1.3677
85 S A -1.1123
86 L A 0.0000
87 K A -2.1611
88 P A -1.8591
89 E A -2.2965
90 D A 0.0000
91 T A -0.9950
92 A A 0.0000
93 V A -0.7631
94 Y A 0.0000
95 Y A -0.1758
96 S A 0.0000
97 Y A 0.6248
98 V A 0.0000
99 Y A 1.6294
100 V A 0.9564
101 G A 0.0451
102 T A 0.2405
103 S A 0.4615
104 Y A 0.3408
105 T A 0.1940
106 G A 0.0000
107 Q A -0.9099
108 G A -0.5109
109 T A 0.0000
110 Q A -1.2305
111 V A 0.0000
112 T A -0.3583
113 V A 0.0000
114 S A -0.7713
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018