Project name: well

Status: done

Started: 2026-03-25 14:43:52
Settings
Chain sequence(s) A: PGVKPIRLFFGQQRRDVYPSALRRLLRFIAPDLVITHMEAHVNEATGRGKGCAWVIVPSVLEAKRLLRLSGRIFLDINSNGEEVYLFAPPNCREWLSEYADYVVSSTTRASHLPYLPMVVGVPKKECIYVRELLAPYIYDPNRGDCPPYADAVSEFKGLLEDHASLPV
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:32)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:33)
Show buried residues

Minimal score value
-3.687
Maximal score value
2.1788
Average score
-0.4351
Total score value
-73.0892

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 P A -0.3359
2 G A -0.1646
3 V A 0.5971
4 K A -1.1870
5 P A -0.8374
6 I A 0.0000
7 R A -0.7178
8 L A 0.0000
9 F A 0.6836
10 F A 0.0000
11 G A 0.2526
12 Q A -0.0518
13 Q A 0.0000
14 R A -1.0173
15 R A -1.8411
16 D A 0.0000
17 V A 0.7677
18 Y A 1.2430
19 P A -0.3145
20 S A -0.3771
21 A A 0.0000
22 L A 0.0000
23 R A -2.9023
24 R A -2.5784
25 L A 0.0000
26 L A 0.0000
27 R A -2.4577
28 F A -1.1400
29 I A 0.0000
30 A A 0.0000
31 P A -1.3215
32 D A -1.5283
33 L A -0.0129
34 V A 1.2671
35 I A 0.5345
36 T A 0.1814
37 H A -1.1701
38 M A 0.0000
39 E A -1.7101
40 A A -0.6368
41 H A -1.2028
42 V A -1.3335
43 N A -2.0583
44 E A -2.4798
45 A A -1.2996
46 T A -1.5171
47 G A -1.8655
48 R A -2.5259
49 G A 0.0000
50 K A -2.4120
51 G A -1.5840
52 C A -0.5677
53 A A 0.0000
54 W A -0.5371
55 V A 0.0000
56 I A -0.0483
57 V A 0.0000
58 P A 0.3575
59 S A 0.5923
60 V A 0.7148
61 L A 1.3522
62 E A 0.8799
63 A A 0.0000
64 K A 0.1306
65 R A 0.0819
66 L A 0.0000
67 L A 0.0000
68 R A 0.0000
69 L A 0.0000
70 S A 0.3333
71 G A -0.0930
72 R A 0.0000
73 I A 0.0000
74 F A 0.0000
75 L A 0.0000
76 D A 0.0000
77 I A -0.0901
78 N A -1.0643
79 S A -1.0813
80 N A -1.7734
81 G A -1.3446
82 E A -1.3517
83 E A -0.9292
84 V A 0.0000
85 Y A 0.0000
86 L A -0.0502
87 F A 0.0000
88 A A 0.0000
89 P A -0.4480
90 P A 0.0000
91 N A -1.6154
92 C A -0.8170
93 R A 0.0000
94 E A -2.1728
95 W A -0.9936
96 L A 0.0000
97 S A -1.2082
98 E A -2.0883
99 Y A -0.6647
100 A A 0.0000
101 D A -1.2251
102 Y A 0.1320
103 V A 0.0000
104 V A 0.1394
105 S A -0.1067
106 S A -0.1984
107 T A -0.0256
108 T A -0.2468
109 R A -0.0709
110 A A -0.2183
111 S A -0.5077
112 H A -1.0517
113 L A 0.0000
114 P A 0.0000
115 Y A 1.2607
116 L A 0.8952
117 P A 0.0000
118 M A 0.0000
119 V A 1.3184
120 V A 0.0000
121 G A 0.3093
122 V A -0.5950
123 P A 0.0000
124 K A -2.3432
125 K A -2.3731
126 E A -1.0961
127 C A 0.4347
128 I A 1.5158
129 Y A 1.5878
130 V A 0.0000
131 R A -0.8159
132 E A -1.0019
133 L A -0.0279
134 L A 0.0000
135 A A -0.4605
136 P A -0.6149
137 Y A -0.0302
138 I A -0.0442
139 Y A -1.0343
140 D A -2.9195
141 P A -2.8136
142 N A -3.1471
143 R A -3.6870
144 G A -2.8312
145 D A -2.5913
146 C A -0.9623
147 P A 0.0000
148 P A 0.2532
149 Y A 0.9507
150 A A 0.0000
151 D A -1.0260
152 A A 0.1108
153 V A 1.0686
154 S A -0.0507
155 E A 0.0000
156 F A 0.0137
157 K A -0.5434
158 G A 0.1304
159 L A 0.9687
160 L A -0.1394
161 E A -1.5050
162 D A 0.0000
163 H A -1.2071
164 A A 0.0000
165 S A -0.3272
166 L A 0.2104
167 P A 0.8219
168 V A 2.1788
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018