Project name: query_structure

Chain sequence(s)	A: QVQLVESGGGSVQAGGSLRLSATASGGSEYSYSTFSLGWFRQAPGQEREAVCAIASMGGLTYYADSVKGRFTCSRDNAKNTVTLQMNNLKPEDTAIYYVAAVRGYFMRLPSSHNFRYWGQGTQVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:05)

• Minimal score value: -3.403
• Maximal score value: 2.0272
• Average score: -0.7461
• Total score value: -95.4964

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.5321
2	V	A	-1.3803
3	Q	A	-1.3987
4	L	A	0.0000
5	V	A	0.0551
6	E	A	-0.5583
7	S	A	-0.9376
8	G	A	-1.3340
9	G	A	-1.2418
10	G	A	-0.9628
11	S	A	-0.7280
12	V	A	-0.7800
13	Q	A	-1.7390
14	A	A	-1.8689
15	G	A	-1.8074
16	G	A	-1.4232
17	S	A	-1.4619
18	L	A	-1.2437
19	R	A	-2.1270
20	L	A	0.0000
21	S	A	-0.7155
22	A	A	0.0000
23	T	A	-0.6280
24	A	A	0.0000
25	S	A	-0.8414
26	G	A	-1.5976
27	G	A	-1.5091
28	S	A	-1.3460
29	E	A	-2.0180
30	Y	A	-1.4551
31	S	A	-1.1976
32	Y	A	0.0000
33	S	A	-0.2186
34	T	A	-0.3910
35	F	A	0.0000
36	S	A	0.0000
37	L	A	0.0000
38	G	A	0.0000
39	W	A	0.0000
40	F	A	0.0000
41	R	A	-1.2981
42	Q	A	-1.9384
43	A	A	-1.8082
44	P	A	-1.2518
45	G	A	-1.7397
46	Q	A	-2.8727
47	E	A	-3.4030
48	R	A	-2.8560
49	E	A	-1.9156
50	A	A	-0.7871
51	V	A	0.0000
52	C	A	0.0000
53	A	A	0.0000
54	I	A	0.0000
55	A	A	1.0838
56	S	A	0.8010
57	M	A	0.9785
58	G	A	0.2318
59	G	A	0.5853
60	L	A	1.5955
61	T	A	0.7235
62	Y	A	0.5234
63	Y	A	-0.7441
64	A	A	0.0000
65	D	A	-2.4060
66	S	A	-1.7626
67	V	A	0.0000
68	K	A	-2.5578
69	G	A	-1.8509
70	R	A	-1.6383
71	F	A	0.0000
72	T	A	-0.7700
73	C	A	0.0000
74	S	A	-0.5584
75	R	A	-0.9332
76	D	A	-1.4558
77	N	A	-1.4125
78	A	A	-1.3364
79	K	A	-2.1792
80	N	A	-1.4529
81	T	A	-1.0709
82	V	A	0.0000
83	T	A	-0.7791
84	L	A	0.0000
85	Q	A	-1.0806
86	M	A	0.0000
87	N	A	-1.7967
88	N	A	-2.2639
89	L	A	0.0000
90	K	A	-2.5895
91	P	A	-1.8840
92	E	A	-2.3104
93	D	A	0.0000
94	T	A	-1.1248
95	A	A	0.0000
96	I	A	-0.4902
97	Y	A	0.0000
98	Y	A	-0.4408
99	V	A	0.0000
100	A	A	0.0000
101	A	A	0.0000
102	V	A	0.0000
103	R	A	-1.6133
104	G	A	0.3545
105	Y	A	1.9529
106	F	A	2.0272
107	M	A	1.1606
108	R	A	-0.4904
109	L	A	0.8973
110	P	A	0.1692
111	S	A	-0.7568
112	S	A	-1.3856
113	H	A	-1.6249
114	N	A	-1.3275
115	F	A	0.0000
116	R	A	-2.1351
117	Y	A	-0.9556
118	W	A	-0.3201
119	G	A	-0.4613
120	Q	A	-1.2557
121	G	A	-0.7428
122	T	A	0.0000
123	Q	A	-1.4262
124	V	A	0.0000
125	T	A	-0.9495
126	V	A	0.0000
127	S	A	-1.1427
128	S	A	-0.8463