Project name: 6f2b272e6f24f4d

Status: done

Started: 2026-05-16 03:19:12
Settings
Chain sequence(s) A: TTVHQQTHQDQTCPDGYTRTNYYCRRDGCGSWCNGAERQQPCIRGPCCCDLTYRTAYEYHVDTW
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:49)
Show buried residues

Minimal score value
-5.527
Maximal score value
0.849
Average score
-1.2182
Total score value
-77.9644

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 T A 0.2251
2 T A 0.3635
3 V A 0.6910
4 H A -1.0313
5 Q A -1.8800
6 Q A -2.4279
7 T A -1.9064
8 H A -2.7237
9 Q A -2.7756
10 D A -2.7357
11 Q A -2.4873
12 T A -1.5235
13 C A 0.0000
14 P A -1.5910
15 D A -1.9962
16 G A -0.6692
17 Y A -0.7048
18 T A -1.2788
19 R A -1.8329
20 T A -1.1494
21 N A -1.8154
22 Y A -1.4204
23 Y A -1.2013
24 C A 0.0000
25 R A -3.9836
26 R A -5.5270
27 D A -4.6030
28 G A -2.2448
29 C A 0.0000
30 G A -0.6753
31 S A -0.2127
32 W A 0.1986
33 C A 0.0000
34 N A -1.0328
35 G A -2.4908
36 A A -3.5374
37 E A -5.2201
38 R A -5.0546
39 Q A -4.1025
40 Q A -2.9104
41 P A -2.0667
42 C A -0.5732
43 I A 0.8423
44 R A -1.0979
45 G A -0.6603
46 P A -0.8622
47 C A 0.0000
48 C A 0.0000
49 C A 0.0000
50 D A -0.5221
51 L A 0.8285
52 T A 0.1555
53 Y A 0.0989
54 R A -1.1201
55 T A -0.5822
56 A A -0.0158
57 Y A 0.3869
58 E A -0.4714
59 Y A 0.5441
60 H A -0.3269
61 V A 0.6103
62 D A -0.7116
63 T A -0.0019
64 W A 0.8490
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018